pT7- 7

$160.00

  • Model: PVT10591
  • 50 Units in Stock
Ask a question


Add to Cart:

pT7-7

PVT10591  Packing 2ug

 

pT7-7 Description

PT7-7 is an Escherichia coli pET expression plasmid.

 

pT7-7 Cloning site

pT7-7-vector

 

pT7-7  Sequence

LOCUS       Exported                2473 bp ds-DNA     circular SYN 19-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..2473
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     misc_feature    25..87
                     /label=MCS
     RBS             92..114
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     promoter        complement(146..164)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    337..477
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(663..1251)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        1467..1571
                     /gene="bla"
                     /label=AmpR promoter
     CDS             1572..2432
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
ORIGIN
        1 aattctcatg tttgacagct tatcatcgat aagcttgggc tgcaggtcga ctctagagga
       61 tccccgggcg cgaattctag ccatatgtat atctccttct taaagttaaa caaaattatt
      121 tctagaggga aaccgttgtg gtctccctat agtgagtcgt attaatttcg aagtctatca
      181 gaagttcgaa tcgctgggcc tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat
      241 gcagctcccg gagacggtca cagcttgtct gtaagcggat gccgggagca gacaagcccg
      301 tcagggcgcg tcagcgggtg ttggcgggtg tcggggcgca gccatgaccc agtcacgtag
      361 cgatagcgga gtgtatatac tggcttaact atgcggcatc agagcagatt gtactgagag
      421 tgcaccatgc ggtgtgaaat accgcacaga tgcgtaagga gaaaataccg catcaggcgc
      481 tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta
      541 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag
      601 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg
      661 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg
      721 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg
      781 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga
      841 agcgtggcgc tttctcaatg ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc
      901 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt
      961 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact
     1021 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg
     1081 cctaactacg gctacactag aaggacagta tttggtatct gcgctctgct gaagccagtt
     1141 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt
     1201 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct
     1261 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg
     1321 gtcatgagat tatcaaaaag gatcttcacc tagatccttt taattcttga agacgaaagg
     1381 gcctcgtgat acgcctattt ttataggtta atgtcatgat aataatggtt tcttagacgt
     1441 caggtggcac ttttcgggga aatgtgcgcg gaacccctat ttgtttattt ttctaaatac
     1501 attcaaatat gtatccgctc atgagacaat aaccctgata aatgcttcaa taatattgaa
     1561 aaaggaagag tatgagtatt caacatttcc gtgtcgccct tattcccttt tttgcggcat
     1621 tttgccttcc tgtttttgct cacccagaaa cgctggtgaa agtaaaagat gctgaagatc
     1681 agttgggtgc acgagtgggt tacatcgaac tggatctcaa cagcggtaag atccttgaga
     1741 gttttcgccc cgaagaacgt tttccaatga tgagcacttt taaagttctg ctatgtggcg
     1801 cggtattatc ccgtgttgac gccgggcaag agcaactcgg tcgccgcata cactattctc
     1861 agaatgactt ggttgagtac tcaccagtca cagaaaagca tcttacggat ggcatgacag
     1921 taagagaatt atgcagtgct gccataacca tgagtgataa cactgcggcc aacttacttc
     1981 tgacaacgat cggaggaccg aaggagctaa ccgctttttt gcacaacatg ggggatcatg
     2041 taactcgcct tgatcgttgg gaaccggagc tgaatgaagc cataccaaac gacgagcgtg
     2101 acaccacgat gcctgtagca atggcaacaa cgttgcgcaa actattaact ggcgaactac
     2161 ttactctagc ttcccggcaa caattaatag actggatgga ggcggataaa gttgcaggac
     2221 cacttctgcg ctcggccctt ccggctggct ggtttattgc tgataaatct ggagccggtg
     2281 agcgtgggtc tcgcggtatc attgcagcac tggggccaga tggtaagccc tcccgtatcg
     2341 tagttatcta cacgacgggg agtcaggcaa ctatggatga acgaaataga cagatcgctg
     2401 agataggtgc ctcactgatt aagcattggt aactgtcaga ccaagtttac tcatatatac
     2461 tttagattga ttt
//
 
Caution:
Product is for research use only!
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart