pT7- GST- His

$193.00

  • Model: PVT10592
  • 50 Units in Stock
Ask a question


Add to Cart:

pT7-GST-His


Catalog No. PVT10592
Packing 2ug

 

pT7-GST-His Information

Alias: pGS- 21a
Function E.coli expression plasmid
Resistance Amp
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pBR322
Copy Low
Promoter T7
Induction IPTG
Forward primer T7
Reverse primer T7-ter

 

pT7-GST-His Description

Pt7-gst-his / pgs-21a is a series of pet expression plasmids of E.coli.

 

pT7-GST-His Sequence

LOCUS       Exported                6169 bp ds-DNA     circular SYN 17-NOV-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..6169

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     source          59..81

                     /organism="Enterobacteria phage T7"

                     /mol_type="genomic DNA"

                     /db_xref="taxon:10760"

     promoter        1..19

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     protein_bind    20..44

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     RBS             59..81

                     /note="efficient ribosome binding site from bacteriophage 

                     T7 gene 10 (Olins and Rangwala, 1989)"

     CDS             101..118

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     CDS             128..781

                     /codon_start=1

                     /product="glutathione S-transferase from Schistosoma 

                     japonicum"

                     /label=GST

                     /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK

                     FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY

                     GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL

                     YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK"

     CDS             818..832

                     /codon_start=1

                     /product="enterokinase recognition and cleavage site"

                     /label=EK

                     /translation="DDDDK"

     CDS             893..910

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      977..1024

                     /label=T7 terminator

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

     rep_origin      1061..1516

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        1543..1647

                     /gene="bla"

                     /label=AmpR promoter

     CDS             1648..2508

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      2679..3267

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    3453..3595

                     /label=bom

                     /note="basis of mobility region from pBR322"

     CDS             complement(3697..3888)

                     /codon_start=1

                     /gene="rop"

                     /product="Rop protein, which maintains plasmids at low copy

                     number"

                     /label=rop

                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

                     DELYRSCLARFGDDGENL"

     CDS             complement(4697..5779)

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /label=lacI

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     promoter        complement(5780..5857)

                     /gene="lacI"

                     /label=lacI promoter

ORIGIN

        1 taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta gaaataattt

       61 tgtttaactt taagaaggag atatacatat gtctggttct catcatcatc atcatcatag

      121 cagcggtatg tcccctatac taggttattg gaaaattaag ggccttgtgc aacccactcg

      181 acttcttttg gaatatcttg aagaaaaata tgaagagcat ttgtatgagc gcgatgaagg

      241 tgataaatgg cgaaacaaaa agtttgaatt gggtttggag tttcccaatc ttccttatta

      301 tattgatggt gatgttaaat taacacagtc tatggccatc atacgttata tagctgacaa

      361 gcacaacatg ttgggtggtt gtccaaaaga gcgtgcagag atttcaatgc ttgaaggagc

      421 ggttttggat attagatacg gtgtttcgag aattgcatat agtaaagact ttgaaactct

      481 caaagttgat tttcttagca agctacctga aatgctgaaa atgttcgaag atcgtttatg

      541 tcataaaaca tatttaaatg gtgatcatgt aacccatcct gacttcatgt tgtatgacgc

      601 tcttgatgtt gttttataca tggacccaat gtgcctggat gcgttcccaa aattagtttg

      661 ttttaaaaaa cgtattgaag ctatcccaca aattgataag tacttgaaat ccagcaagta

      721 tatagcatgg cctttgcagg gctggcaagc cacgtttggt ggtggcgacc atcctccaaa

      781 atcggatctg ggccacacag gccatagatc tggtaccgac gacgacgaca aggccatggc

      841 tgatatcgga tccgaattcg agctcgtcga caagcttgcg gccgcactcg agcaccacca

      901 ccaccaccac tgagatccgg ctgctaacaa agcccgaaag gaagctgagt tggctgctgc

      961 caccgctgag caataactag cataacccct tggggcctct aaacgggtct tgaggggttt

     1021 tttgctgaaa ggaggaacta tatccggatt ggcgaatggg acgcgccctg tagcggcgca

     1081 ttaagcgcgg cgggtgtggt ggttacgcgc agcgtgaccg ctacacttgc cagcgcccta

     1141 gcgcccgctc ctttcgcttt cttcccttcc tttctcgcca cgttcgccgg ctttccccgt

     1201 caagctctaa atcgggggct ccctttaggg ttccgattta gtgctttacg gcacctcgac

     1261 cccaaaaaac ttgattaggg tgatggttca cgtagtgggc catcgccctg atagacggtt

     1321 tttcgccctt tgacgttgga gtccacgttc tttaatagtg gactcttgtt ccaaactgga

     1381 acaacactca accctatctc ggtctattct tttgatttat aagggatttt gccgatttcg

     1441 gcctattggt taaaaaatga gctgatttaa caaaaattta acgcgaattt taacaaaata

     1501 ttaacgttta caatttcagg tggcactttt cggggaaatg tgcgcggaac ccctatttgt

     1561 ttatttttct aaatacattc aaatatgtat ccgctcatga gacaataacc ctgataaatg

     1621 cttcaataat attgaaaaag gaagagtatg agtattcaac atttccgtgt cgcccttatt

     1681 cccttttttg cggcattttg ccttcctgtt tttgctcacc cagaaacgct ggtgaaagta

     1741 aaagatgctg aagatcagtt gggtgcacga gtgggttaca tcgaactgga tctcaacagc

     1801 ggtaagatcc ttgagagttt tcgccccgaa gaacgttttc caatgatgag cacttttaaa

     1861 gttctgctat gtggcgcggt attatcccgt attgacgccg ggcaagagca actcggtcgc

     1921 cgcatacact attctcagaa tgacttggtt gagtactcac cagtcacaga aaagcatctt

     1981 acggatggca tgacagtaag agaattatgc agtgctgcca taaccatgag tgataacact

     2041 gcggccaact tacttctgac aacgatcgga ggaccgaagg agctaaccgc ttttttgcac

     2101 aacatggggg atcatgtaac tcgccttgat cgttgggaac cggagctgaa tgaagccata

     2161 ccaaacgacg agcgtgacac cacgatgcct gcagcaatgg caacaacgtt gcgcaaacta

     2221 ttaactggcg aactacttac tctagcttcc cggcaacaat taatagactg gatggaggcg

     2281 gataaagttg caggaccact tctgcgctcg gcccttccgg ctggctggtt tattgctgat

     2341 aaatctggag ccggtgagcg tgggtctcgc ggtatcattg cagcactggg gccagatggt

     2401 aagccctccc gtatcgtagt tatctacacg acggggagtc aggcaactat ggatgaacga

     2461 aatagacaga tcgctgagat aggtgcctca ctgattaagc attggtaact gtcagaccaa

     2521 gtttactcat atatacttta gattgattta aaacttcatt tttaatttaa aaggatctag

     2581 gtgaagatcc tttttgataa tctcatgacc aaaatccctt aacgtgagtt ttcgttccac

     2641 tgagcgtcag accccgtaga aaagatcaaa ggatcttctt gagatccttt ttttctgcgc

     2701 gtaatctgct gcttgcaaac aaaaaaacca ccgctaccag cggtggtttg tttgccggat

     2761 caagagctac caactctttt tccgaaggta actggcttca gcagagcgca gataccaaat

     2821 actgtccttc tagtgtagcc gtagttaggc caccacttca agaactctgt agcaccgcct

     2881 acatacctcg ctctgctaat cctgttacca gtggctgctg ccagtggcga taagtcgtgt

     2941 cttaccgggt tggactcaag acgatagtta ccggataagg cgcagcggtc gggctgaacg

     3001 gggggttcgt gcacacagcc cagcttggag cgaacgacct acaccgaact gagataccta

     3061 cagcgtgagc tatgagaaag cgccacgctt cccgaaggga gaaaggcgga caggtatccg

     3121 gtaagcggca gggtcggaac aggagagcgc acgagggagc ttccaggggg aaacgcctgg

     3181 tatctttata gtcctgtcgg gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc

     3241 tcgtcagggg ggcggagcct atggaaaaac gccagcaacg cggccttttt acggttcctg

     3301 gccttttgct ggccttttgc tcacatgttc tttcctgcgt tatcccctga ttctgtggat

     3361 aaccgtatta ccgcctttga gtgagctgat accgctcgcc gcagccgaac gaccgagcgc

     3421 agcgagtcag tgagcgagga agcggaagag cgcctgatgc ggtattttct ccttacgcat

     3481 ctgtgcggta tttcacaccg catatatggt gcactctcag tacaatctgc tctgatgccg

     3541 catagttaag ccagtataca ctccgctatc gctacgtgac tgggtcatgg ctgcgccccg

     3601 acacccgcca acacccgctg acgcgccctg acgggcttgt ctgctcccgg catccgctta

     3661 cagacaagct gtgaccgtct ccgggagctg catgtgtcag aggttttcac cgtcatcacc

     3721 gaaacgcgcg aggcagctgc ggtaaagctc atcagcgtgg tcgtgaagcg attcacagat

     3781 gtctgcctgt tcatccgcgt ccagctcgtt gagtttctcc agaagcgtta atgtctggct

     3841 tctgataaag cgggccatgt taagggcggt tttttcctgt ttggtcactg atgcctccgt

     3901 gtaaggggga tttctgttca tgggggtaat gataccgatg aaacgagaga ggatgctcac

     3961 gatacgggtt actgatgatg aacatgcccg gttactggaa cgttgtgagg gtaaacaact

     4021 ggcggtatgg atgcggcggg accagagaaa aatcactcag ggtcaatgcc agcgcttcgt

     4081 taatacagat gtaggtgttc cacagggtag ccagcagcat cctgcgatgc agatccggaa

     4141 cataatggtg cagggcgctg acttccgcgt ttccagactt tacgaaacac ggaaaccgaa

     4201 gaccattcat gttgttgctc aggtcgcaga cgttttgcag cagcagtcgc ttcacgttcg

     4261 ctcgcgtatc ggtgattcat tctgctaacc agtaaggcaa ccccgccagc ctagccgggt

     4321 cctcaacgac aggagcacga tcatgcgcac ccgtggggcc gccatgccgg cgataatggc

     4381 ctgcttctcg ccgaaacgtt tggtggcggg accagtgacg aaggcttgag cgagggcgtg

     4441 caagattccg aataccgcaa gcgacaggcc gatcatcgtc gcgctccagc gaaagcggtc

     4501 ctcgccgaaa atgacccaga gcgctgccgg cacctgtcct acgagttgca tgataaagaa

     4561 gacagtcata agtgcggcga cgatagtcat gccccgcgcc caccggaagg agctgactgg

     4621 gttgaaggct ctcaagggca tcggtcgaga tcccggtgcc taatgagtga gctaacttac

     4681 attaattgcg ttgcgctcac tgcccgcttt ccagtcggga aacctgtcgt gccagctgca

     4741 ttaatgaatc ggccaacgcg cggggagagg cggtttgcgt attgggcgcc agggtggttt

     4801 ttcttttcac cagtgagacg ggcaacagct gattgccctt caccgcctgg ccctgagaga

     4861 gttgcagcaa gcggtccacg ctggtttgcc ccagcaggcg aaaatcctgt ttgatggtgg

     4921 ttaacggcgg gatataacat gagctgtctt cggtatcgtc gtatcccact accgagatgt

     4981 ccgcaccaac gcgcagcccg gactcggtaa tggcgcgcat tgcgcccagc gccatctgat

     5041 cgttggcaac cagcatcgca gtgggaacga tgccctcatt cagcatttgc atggtttgtt

     5101 gaaaaccgga catggcactc cagtcgcctt cccgttccgc tatcggctga atttgattgc

     5161 gagtgagata tttatgccag ccagccagac gcagacgcgc cgagacagaa cttaatgggc

     5221 ccgctaacag cgcgatttgc tggtgaccca atgcgaccag atgctccacg cccagtcgcg

     5281 taccgtcttc atgggagaaa ataatactgt tgatgggtgt ctggtcagag acatcaagaa

     5341 ataacgccgg aacattagtg caggcagctt ccacagcaat ggcatcctgg tcatccagcg

     5401 gatagttaat gatcagccca ctgacgcgtt gcgcgagaag attgtgcacc gccgctttac

     5461 aggcttcgac gccgcttcgt tctaccatcg acaccaccac gctggcaccc agttgatcgg

     5521 cgcgagattt aatcgccgcg acaatttgcg acggcgcgtg cagggccaga ctggaggtgg

     5581 caacgccaat cagcaacgac tgtttgcccg ccagttgttg tgccacgcgg ttgggaatgt

     5641 aattcagctc cgccatcgcc gcttccactt tttcccgcgt tttcgcagaa acgtggctgg

     5701 cctggttcac cacgcgggaa acggtctgat aagagacacc ggcatactct gcgacatcgt

     5761 ataacgttac tggtttcaca ttcaccaccc tgaattgact ctcttccggg cgctatcatg

     5821 ccataccgcg aaaggttttg cgccattcga tggtgtccgg gatctcgacg ctctccctta

     5881 tgcgactcct gcattaggaa gcagcccagt agtaggttga ggccgttgag caccgccgcc

     5941 gcaaggaatg gtgcatgcaa ggagatggcg cccaacagtc ccccggccac ggggcctgcc

     6001 accataccca cgccgaaaca agcgctcatg agcccgaagt ggcgagcccg atcttcccca

     6061 tcggtgatgt cggcgatata ggcgccagca accgcacctg tggcgccggt gatgccggcc

     6121 acgatgcgtc cggcgtagag gatcgagatc gatctcgatc ccgcgaaat

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart