pTA7002- avrPto

$193.00

  • Model: PVT10534
  • 50 Units in Stock
Ask a question


Add to Cart:

pTA7002-avrPto

Catalog No. PVT10534
Packing 2ug

 

pTA7002-avrPto Information

Function Other source plasmids

Replicon: oriV

Plasmid classification: gene library plasmid; other gene plasmids; other source plasmids.

Prokaryotic resistance: kanamycin Kan (50 mu g/ml)

Cloned strains of Escherichia coli, DH5 A and other Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

Note: low copy

 

pTA7002-avrPto Description

Plant transformation binary vector for Dexamethasone inducible expression of the type III effector gene avrPto. lease note: a binary vector-compatible Agrobacterium strain (such as GV3850) will have to be used prior to plant transformation. Plasmid should be grown at 30C after transformation to Agrobacterium (37C is ok for E. coli).

 

pTA7002-avrPto Reference

Proc Natl Acad Sci U S A. 2003 Jul 8;100(14):8577-82. Epub 2003 Jun 19.
A Pseudomonas syringae type III effector suppresses cell wall-based extracellular
defense in susceptible Arabidopsis plants.
Hauck P1, Thilmony R, He SY.
 
 
pTA7002-avrPto Sequence

LOCUS       Exported               14787 bp ds-DNA    circular SYN 16-八月-2017

KEYWORDS    pTA7002-avrPto

FEATURES             Location/Qualifiers

     source          1..14787

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /note="traJ"

                     /protein_id="

                     "

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /note="TetR"

                     /protein_id="

                     "

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /note="RB T-DNA repeat"

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2993..3338

                     /note="CaMV 35S promoter"

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             3600..3833

                     /codon_start=1

                     /gene="UL48"

                     /product="transcriptional activation domain of herpes 

                     simplex virus protein VP16 (Triezenberg et al., 1988; 

                     Cousens et al., 1989)"

                     /note="VP16 AD"

                     /protein_id="

                     "

                     /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF

                     TPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"

     promoter        5125..5341

                     /note="NOS promoter"

                     /note="nopaline synthase promoter"

     terminator      6457..6709

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     promoter        6929..6975

                     /note="minimal CaMV 35S promoter"

                     /note="minimal 35S promoter from cauliflower mosaic virus"

     CDS             7010..7504

                     /codon_start=1

                     /note="avrPto"

                     /translation="MGNICVGGSRMAHQVNSPDRVSNNSGDEDNVTSSQLLSVRHQLAE

                     SAGVPRDQHEFVSNQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHE

                     NVDDMRSAITDWSDMREALQYAMGIHADIPPSPERFVATMNPNGSIRMSTLSPSPYRNW

                     Q"

     misc_feature    8651..8675

                     /note="LB T-DNA repeat"

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(10271..11419)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /note="trfA"

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(11718..12512)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /note="KanR"

                     /note="confers resistance to kanamycin"

                     /protein_id="

                     "

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  12704..13471

                     /mobile_element_type="insertion sequence:IS1"

                     /note="IS1"

                     /note="prokaryotic transposable element"

     rep_origin      14094..18

                     /note="oriV"

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttcctgcagg tccccagatt agccttttca

     2521 atttcagaaa gaatgctaac ccacagatgg ttagagaggc ttacgcagca ggtctcatca

     2581 agacgatcta cccgagcaat aatctccagg aaatcaaata ccttcccaag aaggttaaag

     2641 atgcagtcaa aagattcagg actaactgca tcaagaacac agagaaagat atatttctca

     2701 agatcagaag tactattcca gtatggacga ttcaaggctt gcttcacaaa ccaaggcaag

     2761 taatagagat tggagtctct aaaaaggtag ttcccactga atcaaaggcc atggagtcaa

     2821 agattcaaat agaggaccta acagaactcg ccgtaaagac tggcgaacag ttcatacaga

     2881 gtctcttacg actcaatgac aagaagaaaa tcttcgtcaa catggtggag cacgacacac

     2941 ttgtctactc caaaaatatc aaagatacag tctcagaaga ccaaagggca attgagactt

     3001 ttcaacaaag ggtaatatcc ggaaacctcc tcggattcca ttgcccagct atctgtcact

     3061 ttattgtgaa gatagtggaa aaggaaggtg gctcctacaa atgccatcat tgcgataaag

     3121 gaaaggccat cgttgaagat gcctctgccg acagtggtcc caaagatgga cccccaccca

     3181 cgaggagcat cgtggaaaaa gaagacgttc caaccacgtc ttcaaagcaa gtggattgat

     3241 gtgatatctc cactgacgta agggatgacg cacaatccca ctatccttcg caagaccctt

     3301 cctctatata aggaagttca tttcatttgg agagaacacg ggggactcta gtttaaacaa

     3361 tggcagatcc aatgaagcta ctgtcttcta tcgaacaagc atgcgatatt tgccgactta

     3421 aaaagctcaa gtgctccaaa gaaaaaccga agtgcgccaa gtgtctgaag aacaactggg

     3481 agtgtcgcta ctctcccaaa accaaaaggt ctccgctgac tagggcacat ctgacagaag

     3541 tggaatcaag gctagaaaga ctggaacagc tatttctact gatttttcct aggtcgagcg

     3601 cccccccgac cgatgtcagc ctgggggacg agctccactt agacggcgag gacgtggcga

     3661 tggcgcatgc cgacgcgcta gacgatttcg atctggacat gttgggggac ggggattccc

     3721 cgggtccggg atttaccccc cacgactccg ccccctacgg cgctctggat atggccgact

     3781 tcgagtttga gcagatgttt accgatgccc ttggaattga cgagtacggt ggggatccaa

     3841 ttcagcaagc cactgcagga gtctcacaag acacttcgga aaatcctaac aaaacaatag

     3901 ttcctgctgc attaccacag ctcaccccta ccttggtgtc actgctggag gtgattgaac

     3961 ccgaggtgtt gtatgcagga tatgatagct ctgttccaga ttcagcatgg agaattatga

     4021 ccacactcaa catgttaggt gggcgtcaag tgattgcagc agtgaaatgg gcaaaggcga

     4081 taccaggctt cagaaactta cacctggatg accaaatgac cctgctacag tactcatgga

     4141 tgtttctcat ggcatttgcc ctgggttgga gatcatacag acaatcaagt ggaaacctgc

     4201 tctgctttgc tcctgatctg attattaatg agcagagaat gtctctaccc tgcatgtatg

     4261 accaatgtaa acacatgctg tttgtctcct ctgaattaca aagattgcag gtatcctatg

     4321 aagagtatct ctgtatgaaa accttactgc ttctctcctc agttcctaag gaaggtctga

     4381 agagccaaga gttatttgat gagattcgaa tgacttatat caaagagcta ggaaaagcca

     4441 tcgtcaaaag ggaagggaac tccagtcaga actggcaacg gttttaccaa ctgacaaagc

     4501 ttctggactc catgcatgag gtggttgaga atctccttac ctactgcttc cagacatttt

     4561 tggataagac catgagtatt gaattcccag agatgttagc tgaaatcatc actaatcaga

     4621 taccaaaata ttcaaatgga aatatcaaaa agcttctgtt tcatcaaaaa tgactcgacc

     4681 taactgagta agctagcttg ttcgagtatt atggcattgg gaaaactgtt tttcttgtac

     4741 catttgttgt gcttgtaatt tactgtgttt tttattcggt tttcgctatc gaactgtgaa

     4801 atggaaatgg atggagaaga gttaatgaat gatatggtcc ttttgttcat tctcaaatta

     4861 atattatttg ttttttctct tatttgttgt gtgttgaatt tgaaattata agagatatgc

     4921 aaacattttg ttttgagtaa aaatgtgtca aatcgtggcc tctaatgacc gaagttaata

     4981 tgaggagtaa aacactagat ccccaaacaa gcttgaaact gaaggcggga aacgacaatc

     5041 tgatcatgag cggagaatta agggagtcac gttatgaccc ccgccgatga cgcgggacaa

     5101 gccgttttac gtttggaact gacagaaccg caacgattga aggagccact cagccgcggg

     5161 tttctggagt ttaatgagct aagcacatac gtcagaaacc attattgcgc gttcaaaagt

     5221 cgcctaaggt cactatcagc tagcaaatat ttcttgtcaa aaatgctcca ctgacgttcc

     5281 ataaattccc ctcggtatcc aattagagtc tcatattcac tctcaatcca aataatctgc

     5341 accggatccg ctagaggatc tcgaccctgc aagatcccgg ggggcaatga gatatgaaaa

     5401 agcctgaact caccgcgacg tctgtcgaga agtttctgat cgaaaagttc gacagcgtct

     5461 ccgacctgat gcagctctcg gagggcgaag aatctcgtgc tttcagcttc gatgtaggag

     5521 ggcgtggata tgtcctgcgg gtaaatagct gcgccgatgg tttctacaaa gatcgttatg

     5581 tttatcggca ctttgcatcg gccgcgctcc cgattccgga agtgcttgac attggggaat

     5641 tcagcgagag cctgacctat tgcatctccc gccgtgcaca gggtgtcacg ttgcaagacc

     5701 tgcctgaaac cgaactgccc gctgttctgc agccggtcgc ggaggccatg gatgcgatcg

     5761 ctgcggccga tcttagccag acgagcgggt tcggcccatt cggaccgcaa ggaatcggtc

     5821 aatacactac atggcgtgat ttcatatgcg cgattgctga tccccatgtg tatcactggc

     5881 aaactgtgat ggacgacacc gtcagtgcgt ccgtcgcgca ggctctcgat gagctgatgc

     5941 tttgggccga ggactgcccc gaagtccggc acctcgtgca cgcggatttc ggctccaaca

     6001 atgtcctgac ggacaatggc cgcataacag cggtcattga ctggagcgag gcgatgttcg

     6061 gggattccca atacgaggtc gccaacatct tcttctggag gccgtggttg gcttgtatgg

     6121 agcagcagac gcgctacttc gagcggaggc atccggagct tgcaggatcg ccgcggctcc

     6181 gggcgtatat gctccgcatt ggtcttgacc aactctatca gagcttggtt gacggcaatt

     6241 tcgatgatgc agcttgggcg cagggtcgat gcgacgcaat cgtccgatcc ggagccggga

     6301 ctgtcgggcg tacacaaatc gcccgcagaa gcgcggccgt ctggaccgat ggctgtgtag

     6361 aagtactcgc cgatagtgga aaccgacgcc ccagcactcg tccgggatct tggaggtgat

     6421 gtaacatgat cacaagctga tcccccgaat ttccccgatc gttcaaacat ttggcaataa

     6481 agtttcttaa gattgaatcc tgttgccggt cttgcgatga ttatcatata atttctgttg

     6541 aattacgtta agcatgtaat aattaacatg taatgcatga cgttatttat gagatgggtt

     6601 tttatgatta gagtcccgca attatacatt taatacgcga tagaaaacaa aatatagcgc

     6661 gcaaactagg ataaattatc gcgcgcggtg tcatctatgt tactagatcg ggaattgatc

     6721 ccccctcgac agcttgcatg ccggtcgact ttagaggatc cgggtgacag ccctccgacg

     6781 ggtgacagcc ctccgacggg tgacagccct ccgaattcta gaggatccgg gtgacagccc

     6841 tccgacgggt gacagccctc cgacgggtga cagccctccg aattcgagct cggtacccgg

     6901 ggatctgtcg acctcgatcg agatcttcgc aagacccttc ctctatataa ggaagttcat

     6961 ttcatttgga gaggacacgc tgaagctagt cgactctagc ctcgagacca tgggaaatat

     7021 atgtgtcggc ggatccagga tggcccatca ggtgaactcc ccagaccgag ttagtaacaa

     7081 ctcgggtgac gaagataacg taacgtccag tcaactgctg agcgtcagac atcaacttgc

     7141 ggagtctgct ggtgtaccaa gagatcagca tgaatttgtt agtaaccaag cacctcaaag

     7201 cctgagaaat cgctacaaca atctttactc acatacgcaa agaacactgg atatggcgga

     7261 catgcagcat aggtacatga cgggagcgtc aggaatcaat ccgggaatgc tgccacatga

     7321 gaatgtggac gatatgcgta gcgctataac tgattggagt gacatgcgcg aagctctgca

     7381 gtacgcaatg ggtatccatg ccgacatccc accgtctcca gagcgatttg ttgcgactat

     7441 gaacccgaac ggatcaattc gaatgtcaac actttctcct agcccgtacc gtaactggca

     7501 atgaactagt cgatccaggc ctcccagctt tcgtccgtat catcggtttc gacaacgttc

     7561 gtcaagttca atgcatcagt ttcattgccc acacaccaga atcctactaa gtttgagtat

     7621 tatggcattg gaaaagctgt tttcttctat catttgttct gcttgtaatt tactgtgttc

     7681 tttcagtttt tgttttcgga catcaaaatg caaatggatg gataagagtt aataaatgat

     7741 atggtccttt tgttcattct caaattatta ttatctgttg tttttacttt aatgggttga

     7801 atttaagtaa gaaaggaact aacagtgtga tattaaggtg caatgttaga catataaaac

     7861 agtctttcac ctctctttgg ttatgtcttg aattggtttg tttcttcact tatctgtgta

     7921 atcaagttta ctatgagtct atgatcaagt aattatgcaa tcaagttaag tacagtatag

     7981 gctttttgtg tcgaaggggt accgagtcga gaattcactg gccgtcgttt tacaacgtcg

     8041 tgactgggaa aaccctggcg ttacccaact taatcgcctt gcagcacatc cccctttcgc

     8101 cagctggcgt aatagcgaag aggcccgcac cgatcgccct tcccaacagt tgcgcagcct

     8161 gaatggcgcc cgctcctttc gctttcttcc cttcctttct cgccacgttc gccggctttc

     8221 cccgtcaagc tctaaatcgg gggctccctt tagggttccg atttagtgct ttacggcacc

     8281 tcgaccccaa aaaacttgat ttgggtgatg gttcacgtag tgggccatcg ccctgataga

     8341 cggtttttcg ccctttgacg ttggagtcca cgttctttaa tagtggactc ttgttccaaa

     8401 ctggaacaac actcaaccct atctcgggct attcttttga tttataaggg attttgccga

     8461 tttcggaacc accatcaaac aggattttcg cctgctgggg caaaccagcg tggaccgctt

     8521 gctgcaactc tctcagggcc aggcggtgaa gggcaatcag ctgttgcccg tctcactggt

     8581 gaaaagaaaa accaccccag tacattaaaa acgtccgcaa tgtgttatta agttgtctaa

     8641 gcgtcaattt gtttacacca caatatatcc tgccaccagc cagccaacag ctccccgacc

     8701 ggcagctcgg cacaaaatca ccactcgata caggcagccc atcagtccgg gacggcgtca

     8761 gcgggagagc cgttgtaagg cggcagactt tgctcatgtt accgatgcta ttcggaagaa

     8821 cggcaactaa gctgccgggt ttgaaacacg gatgatctcg cggagggtag catgttgatt

     8881 gtaacgatga cagagcgttg ctgcctgtga tcaaatatca tctccctcgc agagatccga

     8941 attatcagcc ttcttattca tttctcgctt aaccgtgaca ggctgtcgat cttgagaact

     9001 atgccgacat aataggaaat cgctggataa agccgctgag gaagctgagt ggcgctattt

     9061 ctttagaagt gaacgttgac gatatcaact cccctatcca ttgctcaccg aatggtacag

     9121 gtcggggacc cgaagttccg actgtcggcc tgatgcatcc ccggctgatc gaccccagat

     9181 ctggggctga gaaagcccag taaggaaaca actgtaggtt cgagtcgcga gatcccccgg

     9241 aaccaaagga agtaggttaa acccgctccg atcaggccga gccacgccag gccgagaaca

     9301 ttggttcctg taggcatcgg gattggcgga tcaaacacta aagctactgg aacgagcaga

     9361 agtcctccgg ccgccagttg ccaggcggta aaggtgagca gaggcacggg aggttgccac

     9421 ttgcgggtca gcacggttcc gaacgccatg gaaaccgccc ccgccaggcc cgctgcgacg

     9481 ccgacaggat ctagcgctgc gtttggtgtc aacaccaaca gcgccacgcc cgcagttccg

     9541 caaatagccc ccaggaccgc catcaatcgt atcgggctac ctagcagagc ggcagagatg

     9601 aacacgacca tcagcggctg cacagcgcct accgtcgccg cgaccccgcc cggcaggcgg

     9661 tagaccgaaa taaacaacaa gctccagaat agcgaaatat taagtgcgcc gaggatgaag

     9721 atgcgcatcc accagattcc cgttggaatc tgtcggacga tcatcacgag caataaaccc

     9781 gccggcaacg cccgcagcag cataccggcg acccctcggc ctcgctgttc gggctccacg

     9841 aaaacgccgg acagatgcgc cttgtgagcg tccttggggc cgtcctcctg tttgaagacc

     9901 gacagcccaa tgatctcgcc gtcgatgtag gcgccgaatg ccacggcatc tcgcaaccgt

     9961 tcagcgaacg cctccatggg ctttttctcc tcgtgctcgt aaacggaccc gaacatctct

    10021 ggagctttct tcagggccga caatcggatc tcgcggaaat cctgcacgtc ggccgctcca

    10081 agccgtcgaa tctgagcctt aatcacaatt gtcaatttta atcctctgtt tatcggcagt

    10141 tcgtagagcg cgccgtgcgt cccgagcgat actgagcgaa gcaagtgcgt cgagcagtgc

    10201 ccgcttgttc ctgaaatgcc agtaaagcgc tggctgctga acccccagcc ggaactgacc

    10261 ccacaaggcc ctagcgtttg caatgcacca ggtcatcatt gacccaggcg tgttccacca

    10321 ggccgctgcc tcgcaactct tcgcaggctt cgccgacctg ctcgcgccac ttcttcacgc

    10381 gggtggaatc cgatccgcac atgaggcgga aggtttccag cttgagcggg tacggctccc

    10441 ggtgcgagct gaaatagtcg aacatccgtc gggccgtcgg cgacagcttg cggtacttct

    10501 cccatatgaa tttcgtgtag tggtcgccag caaacagcac gacgatttcc tcgtcgatca

    10561 ggacctggca acgggacgtt ttcttgccac ggtccaggac gcggaagcgg tgcagcagcg

    10621 acaccgattc caggtgccca acgcggtcgg acgtgaagcc catcgccgtc gcctgtaggc

    10681 gcgacaggca ttcctcggcc ttcgtgtaat accggccatt gatcgaccag cccaggtcct

    10741 ggcaaagctc gtagaacgtg aaggtgatcg gctcgccgat aggggtgcgc ttcgcgtact

    10801 ccaacacctg ctgccacacc agttcgtcat cgtcggcccg cagctcgacg ccggtgtagg

    10861 tgatcttcac gtccttgttg acgtggaaaa tgaccttgtt ttgcagcgcc tcgcgcggga

    10921 ttttcttgtt gcgcgtggtg aacagggcag agcgggccgt gtcgtttggc atcgctcgca

    10981 tcgtgtccgg ccacggcgca atatcgaaca aggaaagctg catttccttg atctgctgct

    11041 tcgtgtgttt cagcaacgcg gcctgcttgg cctcgctgac ctgttttgcc aggtcctcgc

    11101 cggcggtttt tcgcttcttg gtcgtcatag ttcctcgcgt gtcgatggtc atcgacttcg

    11161 ccaaacctgc cgcctcctgt tcgagacgac gcgaacgctc cacggcggcc gatggcgcgg

    11221 gcagggcagg gggagccagt tgcacgctgt cgcgctcgat cttggccgta gcttgctgga

    11281 ccatcgagcc gacggactgg aaggtttcgc ggggcgcacg catgacggtg cggcttgcga

    11341 tggtttcggc atcctcggcg gaaaaccccg cgtcgatcag ttcttgcctg tatgccttcc

    11401 ggtcaaacgt ccgattcatt caccctcctt gcgggattgc cccgactcac gccggggcaa

    11461 tgtgccctta ttcctgattt gacccgcctg gtgccttggt gtccagataa tccaccttat

    11521 cggcaatgaa gtcggtcccg tagaccgtct ggccgtcctt ctcgtacttg gtattccgaa

    11581 tcttgccctg cacgaatacc agcgacccct tgcccaaata cttgccgtgg gcctcggcct

    11641 gagagccaaa acacttgatg cggaagaagt cggtgcgctc ctgcttgtcg ccggcatcgt

    11701 tgcgccacat ctaggtacta aaacaattca tccagtaaaa tataatattt tattttctcc

    11761 caatcaggct tgatccccag taagtcaaaa aatagctcga catactgttc ttccccgata

    11821 tcctccctga tcgaccggac gcagaaggca atgtcatacc acttgtccgc cctgccgctt

    11881 ctcccaagat caataaagcc acttactttg ccatctttca caaagatgtt gctgtctccc

    11941 aggtcgccgt gggaaaagac aagttcctct tcgggctttt ccgtctttaa aaaatcatac

    12001 agctcgcgcg gatctttaaa tggagtgtct tcttcccagt tttcgcaatc cacatcggcc

    12061 agatcgttat tcagtaagta atccaattcg gctaagcggc tgtctaagct attcgtatag

    12121 ggacaatccg atatgtcgat ggagtgaaag agcctgatgc actccgcata cagctcgata

    12181 atcttttcag ggctttgttc atcttcatac tcttccgagc aaaggacgcc atcggcctca

    12241 ctcatgagca gattgctcca gccatcatgc cgttcaaagt gcaggacctt tggaacaggc

    12301 agctttcctt ccagccatag catcatgtcc ttttcccgtt ccacatcata ggtggtccct

    12361 ttataccggc tgtccgtcat ttttaaatat aggttttcat tttctcccac cagcttatat

    12421 accttagcag gagacattcc ttccgtatct tttacgcagc ggtatttttc gatcagtttt

    12481 ttcaattccg gtgatattct cattttagcc atttattatt tccttcctct tttctacagt

    12541 atttaaagat accccaagaa gctaattata acaagacgaa ctccaattca ctgttccttg

    12601 cattctaaaa ccttaaatac cagaaaacag ctttttcaaa gttgttttca aagttggcgt

    12661 ataacatagt atcgacggag ccgattttga aaccacaatt atgggtgatg ctgccaactt

    12721 actgatttag tgtatgatgg tgtttttgag gtgctccagt ggcttctgtg tctatcagct

    12781 gtccctcctg ttcagctact gacggggtgg tgcgtaacgg caaaagcacc gccggacatc

    12841 agcgctatct ctgctctcac tgccgtaaaa catggcaact gcagttcact tacaccgctt

    12901 ctcaacccgg tacgcaccag aaaatcattg atatggccat gaatggcgtt ggatgccggg

    12961 caacagcccg cattatgggc gttggcctca acacgatttt acgtcactta aaaaactcag

    13021 gccgcagtcg gtaacctcgc gcatacagcc gggcagtgac gtcatcgtct gcgcggaaat

    13081 ggacgaacag tggggctatg tcggggctaa atcgcgccag cgctggctgt tttacgcgta

    13141 tgacagtctc cggaagacgg ttgttgcgca cgtattcggt gaacgcacta tggcgacgct

    13201 ggggcgtctt atgagcctgc tgtcaccctt tgacgtggtg atatggatga cggatggctg

    13261 gccgctgtat gaatcccgcc tgaagggaaa gctgcacgta atcagcaagc gatatacgca

    13321 gcgaattgag cggcataacc tgaatctgag gcagcacctg gcacggctgg gacggaagtc

    13381 gctgtcgttc tcaaaatcgg tggagctgca tgacaaagtc atcgggcatt atctgaacat

    13441 aaaacactat caataagttg gagtcattac ccaattatga tagaatttac aagctataag

    13501 gttattgtcc tgggtttcaa gcattagtcc atgcaagttt ttatgctttg cccattctat

    13561 agatatattg ataagcgcgc tgcctatgcc ttgccccctg aaatccttac atacggcgat

    13621 atcttctata taaaagatat attatcttat cagtattgtc aatatattca aggcaatctg

    13681 cctcctcatc ctcttcatcc tcttcgtctt ggtagctttt taaatatggc gcttcataga

    13741 gtaattctgt aaaggtccaa ttctcgtttt catacctcgg tataatctta cctatcacct

    13801 caaatggttc gctgggttta tcgcaccccc gaacacgagc acggcacccg cgaccactat

    13861 gccaagaatg cccaaggtaa aaattgccgg ccccgccatg aagtccgtga atgccccgac

    13921 ggccgaagtg aagggcaggc cgccacccag gccgccgccc tcactgcccg gcacctggtc

    13981 gctgaatgtc gatgccagca cctgcggcac gtcaatgctt ccgggcgtcg cgctcgggct

    14041 gatcgcccat cccgttactg ccccgatccc ggcaatggca aggactgcca gcgctgccat

    14101 ttttggggtg aggccgttcg cggccgaggg gcgcagcccc tggggggatg ggaggcccgc

    14161 gttagcgggc cgggagggtt cgagaagggg gggcaccccc cttcggcgtg cgcggtcacg

    14221 cgcacagggc gcagccctgg ttaaaaacaa ggtttataaa tattggttta aaagcaggtt

    14281 aaaagacagg ttagcggtgg ccgaaaaacg ggcggaaacc cttgcaaatg ctggattttc

    14341 tgcctgtgga cagcccctca aatgtcaata ggtgcgcccc tcatctgtca gcactctgcc

    14401 cctcaagtgt caaggatcgc gcccctcatc tgtcagtagt cgcgcccctc aagtgtcaat

    14461 accgcagggc acttatcccc aggcttgtcc acatcatctg tgggaaactc gcgtaaaatc

    14521 aggcgttttc gccgatttgc gaggctggcc agctccacgt cgccggccga aatcgagcct

    14581 gcccctcatc tgtcaacgcc gcgccgggtg agtcggcccc tcaagtgtca acgtccgccc

    14641 ctcatctgtc agtgagggcc aagttttccg cgaggtatcc acaacgccgg cggccgcggt

    14701 gtctcgcaca cggcttcgac ggcgtttctg gcgcgtttgc agggccatag acggccgcca

    14761 gcccagcggc gagggcaacc agcccgg

//


Caution
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart