pTALETF_v2 NG Plasmid

$182.00

  • Model: PVT6205
  • 50 Units in Stock
Ask a question


Add to Cart:

pTALETF_v2 NG

Search name

pTALETF_v2 NG,Plasmid pTALETF_v2 NG,pTALETF_v2 NG vector

pTALETF_v2 NG Plasmid information

Plasmid type: mammalian cell expression; targeted gene operation carrier
High copy / low copy: high copy
Cloning methods: polyclonal sites, restrictive endonucleases
Carrier size: 8901 BP
Carrier resistance: Ampicillin; Chloramphenicol
Note: the cloned strain is ccdB Survival
Use:Talen plasmid

pTALETF_v2 NG Plasmid  Sequence

  LOCUS       pTALETF_v2 (NG) 8901 bp  DNA SYN  DEFINITION  pTALETF_v2 (NG)  ACCESSION     KEYWORDS      SOURCE          ORGANISM  other sequences; artificial sequences; vectors.  FEATURES             Location/Qualifiers       source          1..8901                       /organism="pTALETF_v2 (NG)"                       /mol_type="other DNA"       rep_origin      70..689                       /label="pBR322_origin"       promoter        944..960                       /label="M13_forward20_primer"       promoter        1460..2076                       /label="CMV_immearly_promoter"       misc_feature    1539..1826                       /label="CAG_enhancer"       misc_feature    1993..2013                       /label="CMV_fwd_primer"       promoter        2087..2105                       /label="T7_promoter"       CDS             2120..2923                       /label="ORF frame 2"                       /translation="MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPF                       GAHHTEAATGEWDEVQSGLRAADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPA                       AQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAV                       KYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKR                       GGVTAVEAVHAWRNALTGAPLNLTETAAALGTPGFTLYASGSYNVWILS*"       promoter        2876..2899                       /label="lac_promoter"                       /translation="MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPF                       GAHHTEAATGEWDEVQSGLRAADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPA                       AQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAV                       KYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKR                       GGVTAVEAVHAWRNALTGAPLNLTETAAALGTPGFTLYASGSYNVWILS*"       gene            2960..3619                       /label="CAT/CamR"                       /gene="CAT/CamR"                       /translation="MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPF                       GAHHTEAATGEWDEVQSGLRAADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPA                       AQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAV                       KYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKR                       GGVTAVEAVHAWRNALTGAPLNLTETAAALGTPGFTLYASGSYNVWILS*"       CDS             2960..3619                       /label="ORF frame 2"                       /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAF                       LKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETF                       SSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNV                       ANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG                       A*"       misc_feature    3961..4266                       /label="ccdB"                       /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAF                       LKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETF                       SSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNV                       ANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG                       A*"       CDS             4267..5901                       /label="ORF frame 1"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    4915..4935                       /label="SV40 NLS"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    4921..4935                       /label="NLS"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       gene            5185..5898                       /label="EGFP"                       /gene="EGFP"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    complement(5227..5248)                       /label="EGFP_N_primer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    5365..5394                       /label="Y66 (EGFP)"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    5835..5856                       /label="EGFP_C_primer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    complement(5916..5933)                       /label="BGH_rev_primer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    complement(6151..6171)                       /label="pBABE_3_primer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    complement(6157..6372)                       /label="SV40_enhancer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       promoter        6169..6437                       /label="SV40_promoter"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       rep_origin      6336..6413                       /label="SV40_origin"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       misc_feature    6398..6417                       /label="SV40pro_F_primer"                       /translation="MSGSLIHSQSAGRRSRLTPEQVVAIASNGGGRPALESIVAQLSR                       PDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHA                       QVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQR                       WDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRASASPK                       KKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF                       DLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFS                       VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS                       AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN                       YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS                       TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*"       CDS             complement(6471..7292)                       /label="ORF frame 2"                       /translation="MPPLEVARLLLHTSQPRPPEEDVGDLVLGIPEHRLAPVNDRCYA                       AIVRQDIVGAEIRVHEVPDFGAVLGPKHQLIESLRDGRTDGVVHHSLPVIHMGISNRA                       YEITPCSVLTDSLRSEWAEPARLAKIGRSDRIHGLRDRLQNSGQFGFRQVLQRDTLCT                       AGDAIGQALAEFPNVKHFRNRERGRCKVPINITIFVETIGAAIYPQDISTPSYIEAES                       TRFFALRELHQVGDAVELFDQKLLDRRRGEFRLFHHVLIRSENGYTSSRELFAKA*"       CDS             6534..7559                       /label="ORF frame 3"                       /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGR                       GYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQD                       LPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVY                       HWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWS                       EAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQ                       SLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPS                       TRPRAKE*"       gene            6549..7556                       /label="hygroB"                       /gene="hygroB"                       /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGR                       GYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQD                       LPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVY                       HWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWS                       EAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQ                       SLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPS                       TRPRAKE*"       misc_feature    7780..7799                       /label="EBV_rev_primer"                       /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGR                       GYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQD                       LPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVY                       HWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWS                       EAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQ                       SLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPS                       TRPRAKE*"       CDS             complement(7863..8723)                       /label="ORF frame 2"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       promoter        complement(8765..8793)                       /label="AmpR_promoter"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"  ORIGIN      1 CTCATGACCA AAATCCCTTA ACGTGAGTTA CGCGCGCGTC GTTCCACTGA GCGTCAGACC     61 CCGTAGAAAA GATCAAAGGA TCTTCTTGAG ATCCTTTTTT TCTGCGCGTA ATCTGCTGCT    121 TGCAAACAAA AAAACCACCG CTACCAGCGG TGGTTTGTTT GCCGGATCAA GAGCTACCAA    181 CTCTTTTTCC GAAGGTAACT GGCTTCAGCA GAGCGCAGAT ACCAAATACT GTTCTTCTAG    241 TGTAGCCGTA GTTAGCCCAC CACTTCAAGA ACTCTGTAGC ACCGCCTACA TACCTCGCTC    301 TGCTAATCCT GTTACCAGTG GCTGCTGCCA GTGGCGATAA GTCGTGTCTT ACCGGGTTGG    361 ACTCAAGACG ATAGTTACCG GATAAGGCGC AGCGGTCGGG CTGAACGGGG GGTTCGTGCA    421 CACAGCCCAG CTTGGAGCGA ACGACCTACA CCGAACTGAG ATACCTACAG CGTGAGCTAT    481 GAGAAAGCGC CACGCTTCCC GAAGGGAGAA AGGCGGACAG GTATCCGGTA AGCGGCAGGG    541 TCGGAACAGG AGAGCGCACG AGGGAGCTTC CAGGGGGAAA CGCCTGGTAT CTTTATAGTC    601 CTGTCGGGTT TCGCCACCTC TGACTTGAGC GTCGATTTTT GTGATGCTCG TCAGGGGGGC    661 GGAGCCTATG GAAAAACGCC AGCAACGCGG CCTTTTTACG GTTCCTGGCC TTTTGCTGGC    721 CTTTTGCTCA CATGTTCTTT CCTGCGTTAT CCCCTGATTC TGTGGATAAC CGTATTACCG    781 CCTTTGAGTG AGCTGATACC GCTCGCCGCA GCCGAACGAC CGAGCGCAGC GAGTCAGTGA    841 GCGAGGAAGC GGAAGGCGAG AGTAGGGAAC TGCCAGGCAT CAAACTAAGC AGAAGGCCCC    901 TGACGGATGG CCTTTTTGCG TTTCTACAAA CTCTTTCTGT GTTGTAAAAC GACGGCCAGT    961 CTTAAGCTCG GGCCCCCTGG GCGGTTCTGA TAACGAGTAA TCGTTAATCC GCAAATAACG   1021 TAAAAACCCG CTTCGGCGGG TTTTTTTATG GGGGGAGTTT AGGGAAAGAG CATTTGTCAG   1081 AATATTTAAG GGCGCCTGTC ACTTTGCTTG ATATATGAGA ATTATTTAAC CTTATAAATG   1141 AGAAAAAAGC AACGCACTTT AAATAAGATA CGTTGCTTTT TCGATTGATG AACACCTATA   1201 ATTAAACTAT TCATCTATTA TTTATGATTT TTTGTATATA CAATATTTCT AGTTTGTTAA   1261 AGAGAATTAA GAAAATAAAT CTCGAAAATA ATAAAGGGAA AATCAGTTTT TGATATCAAA   1321 ATTATACATG TCAACGATAA TACAAAATAT AATACAAACT ATAAGATGTT ATCAGTATTT   1381 ATTATCATTT AGAATAAATT TTGTGTCGCC CTTAATTGTG AGCGGATAAC AATTACGAGC   1441 TTCATGCACA GTGGCGTTGA CATTGATTAT TGACTAGTTA TTAATAGTAA TCAATTACGG   1501 GGTCATTAGT TCATAGCCCA TATATGGAGT TCCGCGTTAC ATAACTTACG GTAAATGGCC   1561 CGCCTGGCTG ACCGCCCAAC GACCCCCGCC CATTGACGTC AATAATGACG TATGTTCCCA   1621 TAGTAACGCC AATAGGGACT TTCCATTGAC GTCAATGGGT GGAGTATTTA CGGTAAACTG   1681 CCCACTTGGC AGTACATCAA GTGTATCATA TGCCAAGTAC GCCCCCTATT GACGTCAATG   1741 ACGGTAAATG GCCCGCCTGG CATTATGCCC AGTACATGAC CTTATGGGAC TTTCCTACTT   1801 GGCAGTACAT CTACGTATTA GTCATCGCTA TTACCATGGT GATGCGGTTT TGGCAGTACA   1861 TCAATGGGCG TGGATAGCGG TTTGACTCAC GGGGATTTCC AAGTCTCCAC CCCATTGACG   1921 TCAATGGGAG TTTGTTTTGG CACCAAAATC AACGGGACTT TCCAAAATGT CGTAACAACT   1981 CCGCCCCATT GACGCAAATG GGCGGTAGGC GTGTACGGTG GGAGGTCTAT ATAAGCAGAG   2041 CTCTCTGGCT AACTAGAGAA CCCACTGCTT ACTGGCTTAT CGAAATTAAT ACGACTCACT   2101 ATAGGGGCGT ACGGCCACCA TGTCGCGGAC CCGGCTCCCT TCCCCACCCG CACCCAGCCC   2161 AGCGTTTTCG GCCGACTCGT TCTCAGACCT GCTTAGGCAG TTCGACCCCT CACTGTTTAA   2221 CACATCGTTG TTCGACTCCC TTCCTCCGTT TGGGGCGCAC CATACGGAGG CGGCCACCGG   2281 GGAGTGGGAT GAGGTGCAGT CGGGATTGAG AGCTGCGGAT GCACCACCCC CAACCATGCG   2341 GGTGGCCGTC ACCGCTGCCC GACCGCCGAG GGCGAAGCCC GCACCAAGGC GGAGGGCAGC   2401 GCAACCGTCC GACGCAAGCC CCGCAGCGCA AGTAGATTTG AGAACTTTGG GATATTCACA   2461 GCAGCAGCAG GAAAAGATCA AGCCCAAAGT GAGGTCGACA GTCGCGCAGC ATCACGAAGC   2521 GCTGGTGGGT CATGGGTTTA CACATGCCCA CATCGTAGCC TTGTCGCAGC ACCCTGCAGC   2581 CCTTGGCACG GTCGCCGTCA AGTACCAGGA CATGATTGCG GCGTTGCCGG AAGCCACACA   2641 TGAGGCGATC GTCGGTGTGG GGAAACAGTG GAGCGGAGCC CGAGCGCTTG AGGCCCTGTT   2701 GACGGTCGCG GGAGAGCTGA GAGGGCCTCC CCTTCAGCTG GACACGGGCC AGTTGCTGAA   2761 GATCGCGAAG CGGGGAGGAG TCACGGCGGT CGAGGCGGTG CACGCGTGGC GCAATGCGCT   2821 CACGGGAGCA CCCCTCAACC TGACAgagac cGCGGCCGCA TTAGGCACCC CAGGCTTTAC   2881 ACTTTATGCT TCCGGCTCGT ATAATGTGTG GATTTTGAGT TAGGATCCGT CGAGATTTTC   2941 AGGAGCTAAG GAAGCTAAAA TGGAGAAAAA AATCACTGGA TATACCACCG TTGATATATC   3001 CCAATGGCAT CGTAAAGAAC ATTTTGAGGC ATTTCAGTCA GTTGCTCAAT GTACCTATAA   3061 CCAGACCGTT CAGCTGGATA TTACGGCCTT TTTAAAGACC GTAAAGAAAA ATAAGCACAA   3121 GTTTTATCCG GCCTTTATTC ACATTCTTGC CCGCCTGATG AATGCTCATC CGGAATTCCG   3181 TATGGCAATG AAAGACGGTG AGCTGGTGAT ATGGGATAGT GTTCACCCTT GTTACACCGT   3241 TTTCCATGAG CAAACTGAAA CGTTTTCATC GCTCTGGAGT GAATACCACG ACGATTTCCG   3301 GCAGTTTCTA CACATATATT CGCAAGATGT GGCGTGTTAC GGTGAAAACC TGGCCTATTT   3361 CCCTAAAGGG TTTATTGAGA ATATGTTTTT CGTCTCAGCC AATCCCTGGG TGAGTTTCAC   3421 CAGTTTTGAT TTAAACGTGG CCAATATGGA CAACTTCTTC GCCCCCGTTT TCACCATGGG   3481 CAAATATTAT ACGCAAGGCG ACAAGGTGCT GATGCCGCTG GCGATTCAGG TTCATCATGC   3541 CGTTTGTGAT GGCTTCCATG TCGGCAGAAT GCTTAATGAA TTACAACAGT ACTGCGATGA   3601 GTGGCAGGGC GGGGCGTAAA GATCTGGATC CGGCTTACTA AAAGCCAGAT AACAGTATGC   3661 GTATTTGCGC GCTGATTTTT GCGGTATAAG AATATATACT GATATGTATA CCCGAAGTAT   3721 GTCAAAAAGA GGTATGCTAT GAAGCAGCGT ATTACAGTGA CAGTTGACAG CGACAGCTAT   3781 CAGTTGCTCA AGGCATATAT GATGTCAATA TCTCCGGTCT GGTAAGCACA ACCATGCAGA   3841 ATGAAGCCCG TCGTCTGCGT GCCGAACGCT GGAAAGCGGA AAATCAGGAA GGGATGGCTG   3901 AGGTCGCCCG GTTTATTGAA ATGAACGGCT CTTTTGCTGA CGAGAACAGG GGCTGGTGAA   3961 ATGCAGTTTA AGGTTTACAC CTATAAAAGA GAGAGCCGTT ATCGTCTGTT TGTGGATGTA   4021 CAGAGTGATA TTATTGACAC GCCCGGGCGA CGGATGGTGA TCCCCCTGGC CAGTGCACGT   4081 CTGCTGTCAG ATAAAGTCTC CCGTGAACTT TACCCGGTGG TGCATATCGG GGATGAAAGC   4141 TGGCGCATGA TGACCACCGA TATGGCCAGT GTGCCGGTCT CCGTTATCGG GGAAGAAGTG   4201 GCTGATCTCA GCCACCGCGA AAATGACATC AAAAACGCCA TTAACCTGAT GTTCTGGGGA   4261 ATATAAATGT CAGGCTCCCT TATACACAGC CAGTCTGCAG GTCGACggtc tcGACTCACG   4321 CCTGAGCAGG TAGTGGCTAT TGCATCCAAT GGCGGGGGCA GACCCGCACT GGAGTCAATC   4381 GTGGCCCAGC TTTCGAGGCC GGACCCCGCG CTGGCCGCAC TCACTAATGA TCATCTTGTA   4441 GCGCTGGCCT GCCTCGGCGG ACGACCCGCC TTGGATGCGG TGAAGAAGGG GCTCCCGCAC   4501 GCGCCTGCAT TGATTAAGCG GACCAACAGA AGGATTCCCG AGAGGACATC ACATCGAGTG   4561 GCAGATCACG CGCAAGTGGT CCGCGTGCTC GGATTCTTCC AGTGTCACTC CCACCCCGCA   4621 CAAGCGTTCG ATGACGCCAT GACTCAATTT GGTATGTCGA GACACGGACT GCTGCAGCTC   4681 TTTCGTAGAG TCGGTGTCAC AGAACTCGAG GCCCGCTCGG GCACACTGCC TCCCGCCTCC   4741 CAGCGGTGGG ACAGGATTCT CCAAGCGAGC GGTATGAAAC GCGCGAAGCC TTCACCTACG   4801 TCAACTCAGA CACCTGACCA GGCGAGCCTT CATGCGTTCG CAGACTCGCT GGAGAGGGAT   4861 TTGGACGCGC CCTCGCCCAT GCATGAAGGG GACCAAACTC GCGCGTCAGC TAGCCCCAAG   4921 AAGAAGAGAA AGGTGGAGGC CAGCGGTTCC GGACGGGCTG ACGCATTGGA CGATTTTGAT   4981 CTGGATATGC TGGGAAGTGA CGCCCTCGAT GATTTTGACC TTGACATGCT TGGTTCGGAT   5041 GCCCTTGATG ACTTTGACCT CGACATGCTC GGCAGTGACG CCCTTGATGA TTTCGACCTG   5101 GACATGCTGA TTAACTCTAG AGGCAGTGGA GAGGGCAGAG GAAGTCTGCT AACATGCGGT   5161 GACGTCGAGG AGAATCCTGG CCCAGTGAGC AAGGGCGAGG AGCTGTTCAC CGGGGTGGTG   5221 CCCATCCTGG TCGAGCTGGA CGGCGACGTA AACGGCCACA AGTTCAGCGT GTCCGGCGAG   5281 GGCGAGGGCG ATGCCACCTA CGGCAAGCTG ACCCTGAAGT TCATCTGCAC CACCGGCAAG   5341 CTGCCCGTGC CCTGGCCCAC CCTCGTGACC ACCCTGACCT ACGGCGTGCA GTGCTTCAGC   5401 CGCTACCCCG ACCACATGAA GCAGCACGAC TTCTTCAAGT CCGCCATGCC CGAAGGCTAC   5461 GTCCAGGAGC GCACCATCTT CTTCAAGGAC GACGGCAACT ACAAGACCCG CGCCGAGGTG   5521 AAGTTCGAGG GCGACACCCT GGTGAACCGC ATCGAGCTGA AGGGCATCGA CTTCAAGGAG   5581 GACGGCAACA TCCTGGGGCA CAAGCTGGAG TACAACTACA ACAGCCACAA CGTCTATATC   5641 ATGGCCGACA AGCAGAAGAA CGGCATCAAG GTGAACTTCA AGATCCGCCA CAACATCGAG   5701 GACGGCAGCG TGCAGCTCGC CGACCACTAC CAGCAGAACA CCCCCATCGG CGACGGCCCC   5761 GTGCTGCTGC CCGACAACCA CTACCTGAGC ACCCAGTCCG CCCTGAGCAA AGACCCCAAC   5821 GAGAAGCGCG ATCACATGGT CCTGCTGGAG TTCGTGACCG CCGCCGGGAT CACTCTCGGC   5881 ATGGACGAGC TGTACAAGTA AGAATTCAAA ATCAGCCTCG ACTGTGCCTT CTAGTTGCCA   5941 GCCATCTGTT GTTTGCCCCT CCCCCGTGCC TTCCTTGACC CTGGAAGGTG CCACTCCCAC   6001 TGTCCTTTCC TAATAAAATG AGGAAATTGC ATCACAACAC TCAACCCTAT CTCGGTCTAT   6061 TCTTTTGATT TATAAGGGAT TTTGCCGATT TCGGCCTATT GGTTAAAAAA TGAGCTGATT   6121 TAACAAAAAT TTAACGCGAA TTAATTCTGT GGAATGTGTG TCAGTTAGGG TGTGGAAAGT   6181 CCCCAGGCTC CCCAGCAGGC AGAAGTATGC AAAGCATGCA TCTCAATTAG TCAGCAACCA   6241 GGTGTGGAAA GTCCCCAGGC TCCCCAGCAG GCAGAAGTAT GCAAAGCATG CATCTCAATT   6301 AGTCAGCAAC CATAGTCCCG CCCCTAACTC CGCCCATCCC GCCCCTAACT CCGCCCAGTT   6361 CCGCCCATTC TCCGCCCCAT GGCTGACTAA TTTTTTTTAT TTATGCAGAG GCCGAGGCCG   6421 CCTCTGCCTC TGAGCTATTC CAGAAGTAGT GAGGAGGCTT TTTTGGAGGC CTAGGCTTTT   6481 GCAAAAAGCT CCCGGGAGCT TGTATATCCA TTTTCGGATC TGATCAGCAC GTGATGAAAA   6541 AGCCTGAACT CACCGCGACG TCTGTCGAGA AGTTTCTGAT CGAAAAGTTC GACAGCGTCT   6601 CCGACCTGAT GCAGCTCTCG GAGGGCGAAG AATCTCGTGC TTTCAGCTTC GATGTAGGAG   6661 GGCGTGGATA TGTCCTGCGG GTAAATAGCT GCGCCGATGG TTTCTACAAA GATCGTTATG   6721 TTTATCGGCA CTTTGCATCG GCCGCGCTCC CGATTCCGGA AGTGCTTGAC ATTGGGGAAT   6781 TCAGCGAGAG CCTGACCTAT TGCATCTCCC GCCGTGCACA GGGTGTCACG TTGCAAGACC   6841 TGCCTGAAAC CGAACTGCCC GCTGTTCTGC AGCCGGTCGC GGAGGCCATG GATGCGATCG   6901 CTGCGGCCGA TCTTAGCCAG ACGAGCGGGT TCGGCCCATT CGGACCGCAA GGAATCGGTC   6961 AATACACTAC ATGGCGTGAT TTCATATGCG CGATTGCTGA TCCCCATGTG TATCACTGGC   7021 AAACTGTGAT GGACGACACC GTCAGTGCGT CCGTCGCGCA GGCTCTCGAT GAGCTGATGC   7081 TTTGGGCCGA GGACTGCCCC GAAGTCCGGC ACCTCGTGCA CGCGGATTTC GGCTCCAACA   7141 ATGTCCTGAC GGACAATGGC CGCATAACAG CGGTCATTGA CTGGAGCGAG GCGATGTTCG   7201 GGGATTCCCA ATACGAGGTC GCCAACATCT TCTTCTGGAG GCCGTGGTTG GCTTGTATGG   7261 AGCAGCAGAC GCGCTACTTC GAGCGGAGGC ATCCGGAGCT TGCAGGATCG CCGCGGCTCC   7321 GGGCGTATAT GCTCCGCATT GGTCTTGACC AACTCTATCA GAGCTTGGTT GACGGCAATT   7381 TCGATGATGC AGCTTGGGCG CAGGGTCGAT GCGACGCAAT CGTCCGATCC GGAGCCGGGA   7441 CTGTCGGGCG TACACAAATC GCCCGCAGAA GCGCGGCCGT CTGGACCGAT GGCTGTGTAG   7501 AAGTACTCGC CGATAGTGGA AACCGACGCC CCAGCACTCG TCCGAGGGCA AAGGAATAGC   7561 ACGTGCTACG AGATTTCGAT TCCACCGCCG CCTTCTATGA AAGGTTGGGC TTCGGAATCG   7621 TTTTCCGGGA CGCCGGCTGG ATGATCCTCC AGCGCGGGGA TCTCATGCTG GAGTTCTTCG   7681 CCCACCCCAA CTTGTTTATT GCAGCTTATA ATGGTTACAA ATAAAGCAAT AGCATCACAA   7741 ATTTCACAAA TAAAGCATTT TTTTCACTGC ATTCTAGTTG TGGTTTGTCC AAACTCATCA   7801 ATGTATCTTA TCATGTCTGT ATACCGTCGA CCTCTAGCTA GAGCTTGGCG TAATCATGGT   7861 CATTACCAAT GCTTAATCAG TGAGGCACCT ATCTCAGCGA TCTGTCTATT TCGTTCATCC   7921 ATAGTTGCCT GACTCCCCGT CGTGTAGATA ACTACGATAC GGGAGGGCTT ACCATCTGGC   7981 CCCAGCGCTG CGATGATACC GCGAGAACCA CGCTCACCGG CTCCGGATTT ATCAGCAATA   8041 AACCAGCCAG CCGGAAGGGC CGAGCGCAGA AGTGGTCCTG CAACTTTATC CGCCTCCATC   8101 CAGTCTATTA ATTGTTGCCG GGAAGCTAGA GTAAGTAGTT CGCCAGTTAA TAGTTTGCGC   8161 AACGTTGTTG CCATCGCTAC AGGCATCGTG GTGTCACGCT CGTCGTTTGG TATGGCTTCA   8221 TTCAGCTCCG GTTCCCAACG ATCAAGGCGA GTTACATGAT CCCCCATGTT GTGCAAAAAA   8281 GCGGTTAGCT CCTTCGGTCC TCCGATCGTT GTCAGAAGTA AGTTGGCCGC AGTGTTATCA   8341 CTCATGGTTA TGGCAGCACT GCATAATTCT CTTACTGTCA TGCCATCCGT AAGATGCTTT   8401 TCTGTGACTG GTGAGTACTC AACCAAGTCA TTCTGAGAAT AGTGTATGCG GCGACCGAGT   8461 TGCTCTTGCC CGGCGTCAAT ACGGGATAAT ACCGCGCCAC ATAGCAGAAC TTTAAAAGTG   8521 CTCATCATTG GAAAACGTTC TTCGGGGCGA AAACTCTCAA GGATCTTACC GCTGTTGAGA   8581 TCCAGTTCGA TGTAACCCAC TCGTGCACCC AACTGATCTT CAGCATCTTT TACTTTCACC   8641 AGCGTTTCTG GGTGAGCAAA AACAGGAAGG CAAAATGCCG CAAAAAAGGG AATAAGGGCG   8701 ACACGGAAAT GTTGAATACT CATATTCTTC CTTTTTCAAT ATTATTGAAG CATTTATCAG   8761 GGTTATTGTC TCATGAGCGG ATACATATTT GAATGTATTT AGAAAAATAA ACAAATAGGG   8821 GTCAGTGTTA CAACCAATTA ACCAATTCTG AACATTATCG CGAGCCCATT TATACCTGAA   8881 TATGGCTCAT AACACCCCTT G
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart