pTCK303- Stuffer

$193.00

  • Model: PVT11221
  • 50 Units in Stock
Ask a question


Add to Cart:

pTCK303-Stuffer


Catalog No. PVT11221
Packing 2ug

 

pTCK303-Stuffer Information

Function plant plasmids

Promoter: Ubi

Replicon: ori

Terminator: NOS

Plasmid classification: plant series, RNAi vector

Prokaryotic resistance: kanamycin Kan

Screening markers: hygromycin HygR

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: plant cells

 

pTCK303-Stuffer Description

pTCK303-Stuffer -RNA interferences (RNAi) has proven to be an effective strategy to knock out homologous genes in a wide range of species. Based on its principle, a new generation of vectors containing an inverted target sequence separated by an intron as a loop, developing simplifications to the procedure of RNAi construction are required to improve the efficiency of gene inactivation techniques. Here, a novel polymerase chain reaction (PCR)—based RNAi vector pTCK303 with a maize ubiquitin promoter, 2 specific multiple enzyme sites, and a rice intron was constructed for monocot gene silencing. With this vector, only 1 PCR product amplified by a single pair of primers and 2 ligation reactions were needed to create an RNAi construct, which shortened the time span before being transformed into the plant. To test the efficiency of vector pTCK303, a rice geneOsGAS1 was used, and its RNAi construct was introduced into rice calli. Southern blot analysis of the transgenic rice confirmed the presence of theOsGAS1 RNAi structure. The decrease inOsGAS1 level in the transgenic rice was detected by Northern blot probed with anOsGAS1-specific sequence. Moreover, the rate of inhibition of the RNA expression level in RNAi transgenic rice was approximately 85% according to our real-time PCR. Therefore, the RNAi vector pTCK303 based on the homology-dependent gene-silencing mechanisms facilitated the inhibition of endogenous genes in a monocot and was proven to be a practical and efficient platform for silencing a rice gene.

 

pTCK303-Stuffer Sequence

LOCUS       Exported               14856 bp ds-DNA     circular SYN 15-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..14856

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             join(1..9,200..2017)

                     /codon_start=1

                     /product="beta-glucuronidase"

                     /label=GUS

                     /note="This version of the gusA gene has a 5' extension 

                     with a catalase intron to ensure expression in plants but 

                     not bacteria."

                     /translation="DLRNRRLVRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESAL

                     QESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVW

                     VNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKK

                     QSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVEL

                     RDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELEVTAKSQTESDIYPLRVGIRSVA

                     VKGQQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYA

                     EEMLDWADEHGIVVIDETAAVGFQLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIK

                     ELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAH

                     TDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLA

                     GLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGI

                     FTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ"

     intron          10..199

                     /label=cat1 intron

                     /note="castor bean catalase intron, modified"

     CDS             2024..2041

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      2076..2328

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    2350..2374

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             3674..4303

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     misc_feature    6408..6548

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(6734..7322)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7409..8203)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    8628..8652

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    8730..8904

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(8944..9969)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(10036..10713)

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     terminator      11036..11288

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    11305..11546

                     /label=Stuffer

     misc_feature    11553..12060

                     /label=Rice intron

     promoter        complement(12088..14080)

                     /label=Ubi promoter

                     /note="maize polyubiquitin gene promoter"

     promoter        14489..14834

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

ORIGIN

        1 gatctgaggg taaatttcta gtttttctcc ttcattttct tggttaggac ccttttctct

       61 ttttattttt ttgagctttg atctttcttt aaactgatct attttttaat tgattggtta

      121 tggtgtaaat attacatagc tttaactgat aatctgatta ctttatttcg tgtgtctatg

      181 atgatgatga tagttacaga accgacgact cgtccgtcct gtagaaaccc caacccgtga

      241 aatcaaaaaa ctcgacggcc tgtgggcatt cagtctggat cgcgaaaact gtggaattga

      301 tcagcgttgg tgggaaagcg cgttacaaga aagccgggca attgctgtgc caggcagttt

      361 taacgatcag ttcgccgatg cagatattcg taattatgcg ggcaacgtct ggtatcagcg

      421 cgaagtcttt ataccgaaag gttgggcagg ccagcgtatc gtgctgcgtt tcgatgcggt

      481 cactcattac ggcaaagtgt gggtcaataa tcaggaagtg atggagcatc agggcggcta

      541 tacgccattt gaagccgatg tcacgccgta tgttattgcc gggaaaagtg tacgtatcac

      601 cgtttgtgtg aacaacgaac tgaactggca gactatcccg ccgggaatgg tgattaccga

      661 cgaaaacggc aagaaaaagc agtcttactt ccatgatttc tttaactatg ccggaatcca

      721 tcgcagcgta atgctctaca ccacgccgaa cacctgggtg gacgatatca ccgtggtgac

      781 gcatgtcgcg caagactgta accacgcgtc tgttgactgg caggtggtgg ccaatggtga

      841 tgtcagcgtt gaactgcgtg atgcggatca acaggtggtt gcaactggac aaggcactag

      901 cgggactttg caagtggtga atccgcacct ctggcaaccg ggtgaaggtt atctctatga

      961 actcgaagtc acagccaaaa gccagacaga gtctgatatc tacccgcttc gcgtcggcat

     1021 ccggtcagtg gcagtgaagg gccaacagtt cctgattaac cacaaaccgt tctactttac

     1081 tggctttggt cgtcatgaag atgcggactt acgtggcaaa ggattcgata acgtgctgat

     1141 ggtgcacgac cacgcattaa tggactggat tggggccaac tcctaccgta cctcgcatta

     1201 cccttacgct gaagagatgc tcgactgggc agatgaacat ggcatcgtgg tgattgatga

     1261 aactgctgct gtcggctttc agctgtcttt aggcattggt ttcgaagcgg gcaacaagcc

     1321 gaaagaactg tacagcgaag aggcagtcaa cggggaaact cagcaagcgc acttacaggc

     1381 gattaaagag ctgatagcgc gtgacaaaaa ccacccaagc gtggtgatgt ggagtattgc

     1441 caacgaaccg gatacccgtc cgcaaggtgc acgggaatat ttcgcgccac tggcggaagc

     1501 aacgcgtaaa ctcgacccga cgcgtccgat cacctgcgtc aatgtaatgt tctgcgacgc

     1561 tcacaccgat accatcagcg atctctttga tgtgctgtgc ctgaaccgtt attacggatg

     1621 gtatgtccaa agcggcgatt tggaaacggc agagaaggta ctggaaaaag aacttctggc

     1681 ctggcaggag aaactgcatc agccgattat catcaccgaa tacggcgtgg atacgttagc

     1741 cgggctgcac tcaatgtaca ccgacatgtg gagtgaagag tatcagtgtg catggctgga

     1801 tatgtatcac cgcgtctttg atcgcgtcag cgccgtcgtc ggtgaacagg tatggaattt

     1861 cgccgatttt gcgacctcgc aaggcatatt gcgcgttggc ggtaacaaga aagggatctt

     1921 cactcgcgac cgcaaaccga agtcggcggc ttttctgctg caaaaacgct ggactggcat

     1981 gaacttcggt gaaaaaccgc agcagggagg caaacaagct agccaccacc accaccacca

     2041 cgtgtgaatt acaggtgacc agctcgaatt tccccgatcg ttcaaacatt tggcaataaa

     2101 gtttcttaag attgaatcct gttgccggtc ttgcgatgat tatcatataa tttctgttga

     2161 attacgttaa gcatgtaata attaacatgt aatgcatgac gttatttatg agatgggttt

     2221 ttatgattag agtcccgcaa ttatacattt aatacgcgat agaaaacaaa atatagcgcg

     2281 caaactagga taaattatcg cgcgcggtgt catctatgtt actagatcgg gaattaaact

     2341 atcagtgttt gacaggatat attggcgggt aaacctaaga gaaaagagcg tttattagaa

     2401 taacggatat ttaaaagggc gtgaaaaggt ttatccgttc gtccatttgt atgtgcatgc

     2461 caaccacagg gttcccctcg ggatcaaagt actttgatcc aacccctccg ctgctatagt

     2521 gcagtcggct tctgacgttc agtgcagccg tcttctgaaa acgacatgtc gcacaagtcc

     2581 taagttacgc gacaggctgc cgccctgccc ttttcctggc gttttcttgt cgcgtgtttt

     2641 agtcgcataa agtagaatac ttgcgactag aaccggagac attacgccat gaacaagagc

     2701 gccgccgctg gcctgctggg ctatgcccgc gtcagcaccg acgaccagga cttgaccaac

     2761 caacgggccg aactgcacgc ggccggctgc accaagctgt tttccgagaa gatcaccggc

     2821 accaggcgcg accgcccgga gctggccagg atgcttgacc acctacgccc tggcgacgtt

     2881 gtgacagtga ccaggctaga ccgcctggcc cgcagcaccc gcgacctact ggacattgcc

     2941 gagcgcatcc aggaggccgg cgcgggcctg cgtagcctgg cagagccgtg ggccgacacc

     3001 accacgccgg ccggccgcat ggtgttgacc gtgttcgccg gcattgccga gttcgagcgt

     3061 tccctaatca tcgaccgcac ccggagcggg cgcgaggccg ccaaggcccg aggcgtgaag

     3121 tttggccccc gccctaccct caccccggca cagatcgcgc acgcccgcga gctgatcgac

     3181 caggaaggcc gcaccgtgaa agaggcggct gcactgcttg gcgtgcatcg ctcgaccctg

     3241 taccgcgcac ttgagcgcag cgaggaagtg acgcccaccg aggccaggcg gcgcggtgcc

     3301 ttccgtgagg acgcattgac cgaggccgac gccctggcgg ccgccgagaa tgaacgccaa

     3361 gaggaacaag catgaaaccg caccaggacg gccaggacga accgtttttc attaccgaag

     3421 agatcgaggc ggagatgatc gcggccgggt acgtgttcga gccgcccgcg cacgtctcaa

     3481 ccgtgcggct gcatgaaatc ctggccggtt tgtctgatgc caagctggcg gcctggccgg

     3541 ccagcttggc cgctgaagaa accgagcgcc gccgtctaaa aaggtgatgt gtatttgagt

     3601 aaaacagctt gcgtcatgcg gtcgctgcgt atatgatgcg atgagtaaat aaacaaatac

     3661 gcaaggggaa cgcatgaagg ttatcgctgt acttaaccag aaaggcgggt caggcaagac

     3721 gaccatcgca acccatctag cccgcgccct gcaactcgcc ggggccgatg ttctgttagt

     3781 cgattccgat ccccagggca gtgcccgcga ttgggcggcc gtgcgggaag atcaaccgct

     3841 aaccgttgtc ggcatcgacc gcccgacgat tgaccgcgac gtgaaggcca tcggccggcg

     3901 cgacttcgta gtgatcgacg gagcgcccca ggcggcggac ttggctgtgt ccgcgatcaa

     3961 ggcagccgac ttcgtgctga ttccggtgca gccaagccct tacgacatat gggccaccgc

     4021 cgacctggtg gagctggtta agcagcgcat tgaggtcacg gatggaaggc tacaagcggc

     4081 ctttgtcgtg tcgcgggcga tcaaaggcac gcgcatcggc ggtgaggttg ccgaggcgct

     4141 ggccgggtac gagctgccca ttcttgagtc ccgtatcacg cagcgcgtga gctacccagg

     4201 cactgccgcc gccggcacaa ccgttcttga atcagaaccc gagggcgacg ctgcccgcga

     4261 ggtccaggcg ctggccgctg aaattaaatc aaaactcatt tgagttaatg aggtaaagag

     4321 aaaatgagca aaagcacaaa cacgctaagt gccggccgtc cgagcgcacg cagcagcaag

     4381 gctgcaacgt tggccagcct ggcagacacg ccagccatga agcgggtcaa ctttcagttg

     4441 ccggcggagg atcacaccaa gctgaagatg tacgcggtac gccaaggcaa gaccattacc

     4501 gagctgctat ctgaatacat cgcgcagcta ccagagtaaa tgagcaaatg aataaatgag

     4561 tagatgaatt ttagcggcta aaggaggcgg catggaaaat caagaacaac caggcaccga

     4621 cgccgtggaa tgccccatgt gtggaggaac gggcggttgg ccaggcgtaa gcggctgggt

     4681 tgtctgccgg ccctgcaatg gcactggaac ccccaagccc gaggaatcgg cgtgacggtc

     4741 gcaaaccatc cggcccggta caaatcggcg cggcgctggg tgatgacctg gtggagaagt

     4801 tgaaggccgc gcaggccgcc cagcggcaac gcatcgaggc agaagcacgc cccggtgaat

     4861 cgtggcaagc ggccgctgat cgaatccgca aagaatcccg gcaaccgccg gcagccggtg

     4921 cgccgtcgat taggaagccg cccaagggcg acgagcaacc agattttttc gttccgatgc

     4981 tctatgacgt gggcacccgc gatagtcgca gcatcatgga cgtggccagt tttaaagagt

     5041 tttaggcgga aaaatcgcct tttttctctt ttatatcagt cacttacatg tgtgaccggt

     5101 tcccaatgta cggctttggg ttcccaatgt acgggttccg gttcccaatg tacggctttg

     5161 ggttcccaat gtacgtgcta tccacaggaa agagaccttt tcgacctttt tcccctgcta

     5221 gggcaatttg ccctagcatc tgctccgtac attaggaacc ggcggatgct tcgccctcga

     5281 tcaggttgcg gtagcgcatg actaggatcg ggccagcctg ccccgcctcc tccttcaaat

     5341 cgtactccgg caggtcattt gacccgatca gcttgcgcac ggtgaaacag aacttcttga

     5401 actctccggc gctgccactg cgttcgtaga tcgtcttgaa caaccatctg gcttctgcct

     5461 tgcctgcggc gcggcgtgcc aggcggtaga gaaaacggcc gatgccggga tcgatcaaaa

     5521 agtaatcggg gtgaaccgtc agcacgtccg ggttcttgcc ttctgtgatc tcgcggtaca

     5581 tccaatcagc tagctcgatc tcgatgtact ccggccgccc ggtttcgctc tttacgatct

     5641 tgtagcggct aatcaaggct tcaccctcgg ataccgtcac caggcggccg ttcttggcct

     5701 tcttcgtacg ctgcatggca acgtgcgtgg tgtttaaccg aatgcaggtt tctaccaggt

     5761 cgtctttctg ctttccgcca tcggctcgcc ggcagaactt gagtacgtcc gcaacgtgtg

     5821 gacggaacac gcggccgggc ttgtctccct tcccttcccg gtatcggttc atggattcgg

     5881 ttagatggga aaccgccatc agtaccaggt cgtaatccca cacactggcc atgccggccg

     5941 gccctgcgga aacctctacg tgcccgtctg gaagctcgta gcggatcacc tcgccagctc

     6001 gtcggtcacg cttcgacaga cggaaaacta ttaaaactct taaaacccgc ctggcctgtg

     6061 cataactgtc tggccagcgc acagccgaag agctgcaaaa agcgcctacc cttcggtcgc

     6121 tgcgctccct acgccccgcc gcttcgcgtc ggcctatcgc ggccgctggc cgctcaaaaa

     6181 tggctggcct acggccaggc aatctaccag ggcgcggaca agccgcgccg tcgccactcg

     6241 accgccggcg cccacatcaa ggcaccctgc ctcgcgcgtt tcggtgatga cggtgaaaac

     6301 ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc

     6361 agacaagccc gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc

     6421 cagtcacgta gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg

     6481 tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc

     6541 gcatcaggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc

     6601 ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata

     6661 acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg

     6721 cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct

     6781 caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa

     6841 gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc

     6901 tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt

     6961 aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg

     7021 ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg

     7081 cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct

     7141 tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc

     7201 tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg

     7261 ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc

     7321 aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt

     7381 aagggatttt ggtcatgcat tctaggtact aaaacaattc atccagtaaa atataatatt

     7441 ttattttctc ccaatcaggc ttgatcccca gtaagtcaaa aaatagctcg acatactgtt

     7501 cttccccgat atcctccctg atcgaccgga cgcagaaggc aatgtcatac cacttgtccg

     7561 ccctgccgct tctcccaaga tcaataaagc cacttacttt gccatctttc acaaagatgt

     7621 tgctgtctcc caggtcgccg tgggaaaaga caagttcctc ttcgggcttt tccgtcttta

     7681 aaaaatcata cagctcgcgc ggatctttaa atggagtgtc ttcttcccag ttttcgcaat

     7741 ccacatcggc cagatcgtta ttcagtaagt aatccaattc ggctaagcgg ctgtctaagc

     7801 tattcgtata gggacaatcc gatatgtcga tggagtgaaa gagcctgatg cactccgcat

     7861 acagctcgat aatcttttca gggctttgtt catcttcata ctcttccgag caaaggacgc

     7921 catcggcctc actcatgagc agattgctcc agccatcatg ccgttcaaag tgcaggacct

     7981 ttggaacagg cagctttcct tccagccata gcatcatgtc cttttcccgt tccacatcat

     8041 aggtggtccc tttataccgg ctgtccgtca tttttaaata taggttttca ttttctccca

     8101 ccagcttata taccttagca ggagacattc cttccgtatc ttttacgcag cggtattttt

     8161 cgatcagttt tttcaattcc ggtgatattc tcattttagc catttattat ttccttcctc

     8221 ttttctacag tatttaaaga taccccaaga agctaattat aacaagacga actccaattc

     8281 actgttcctt gcattctaaa accttaaata ccagaaaaca gctttttcaa agttgttttc

     8341 aaagttggcg tataacatag tatcgacgga gccgattttg aaaccgcggt gatcacaggc

     8401 agcaacgctc tgtcatcgtt acaatcaaca tgctaccctc cgcgagatca tccgtgtttc

     8461 aaacccggca gcttagttgc cgttcttccg aatagcatcg gtaacatgag caaagtctgc

     8521 cgccttacaa cggctctccc gctgacgccg tcccggactg atgggctgcc tgtatcgagt

     8581 ggtgattttg tgccgagctg ccggtcgggg agctgttggc tggctggtgg caggatatat

     8641 tgtggtgtaa acaaattgac gcttagacaa cttaataaca cattgcggac gtttttaatg

     8701 tactgaatta acgccgaatt aattcggggg atctggattt tagtactgga ttttggtttt

     8761 aggaattaga aattttattg atagaagtat tttacaaata caaatacata ctaagggttt

     8821 cttatatgct caacacatga gcgaaaccct ataggaaccc taattccctt atctgggaac

     8881 tactcacaca ttattatgga gaaactcgag cttgtcgatc gacagatccg gtcggcatct

     8941 actctatttc tttgccctcg gacgagtgct ggggcgtcgg tttccactat cggcgagtac

     9001 ttctacacag ccatcggtcc agacggccgc gcttctgcgg gcgatttgtg tacgcccgac

     9061 agtcccggct ccggatcgga cgattgcgtc gcatcgaccc tgcgcccaag ctgcatcatc

     9121 gaaattgccg tcaaccaagc tctgatagag ttggtcaaga ccaatgcgga gcatatacgc

     9181 ccggagtcgt ggcgatcctg caagctccgg atgcctccgc tcgaagtagc gcgtctgctg

     9241 ctccatacaa gccaaccacg gcctccagaa gaagatgttg gcgacctcgt attgggaatc

     9301 cccgaacatc gcctcgctcc agtcaatgac cgctgttatg cggccattgt ccgtcaggac

     9361 attgttggag ccgaaatccg cgtgcacgag gtgccggact tcggggcagt cctcggccca

     9421 aagcatcagc tcatcgagag cctgcgcgac ggacgcactg acggtgtcgt ccatcacagt

     9481 ttgccagtga tacacatggg gatcagcaat cgcgcatatg aaatcacgcc atgtagtgta

     9541 ttgaccgatt ccttgcggtc cgaatgggcc gaacccgctc gtctggctaa gatcggccgc

     9601 agcgatcgca tccatagcct ccgcgaccgg ttgtagaaca gcgggcagtt cggtttcagg

     9661 caggtcttgc aacgtgacac cctgtgcacg gcgggagatg caataggtca ggctctcgct

     9721 aaactcccca atgtcaagca cttccggaat cgggagcgcg gccgatgcaa agtgccgata

     9781 aacataacga tctttgtaga aaccatcggc gcagctattt acccgcagga catatccacg

     9841 ccctcctaca tcgaagctga aagcacgaga ttcttcgccc tccgagagct gcatcaggtc

     9901 ggagacgctg tcgaactttt cgatcagaaa cttctcgaca gacgtcgcgg tgagttcagg

     9961 ctttttcata tctcattgcc ccccgggatc tgcgaaagct cgaggagata gatttgtaga

    10021 gagagactgg tgatttcagc gtgtcctctc caaatgaaat gaacttcctt atatagagga

    10081 aggtcttgcg aaggatagtg ggattgtgcg tcatccctta cgtcagtgga gatatcacat

    10141 caatccactt gctttgaaga cgtggttgga acgtcttctt tttccacgat gctcctcgtg

    10201 ggtgggggtc catctttggg accactgtcg gcagaggcat cttgaacgat agcctttcct

    10261 ttatcgcaat gatggcattt gtaggtgcca ccttcctttt ctactgtcct tttgatgaag

    10321 tgacagatag ctgggcaatg gaatccgagg aggtttcccg atattaccct ttgttgaaaa

    10381 gtctcaatag ccctttggtc ttctgagact gtatctttga tattcttgga gtagacgaga

    10441 gtgtcgtgct ccaccatgtt atcacatcaa tccacttgct ttgaagacgt ggttggaacg

    10501 tcttcttttt ccacgatgct cctcgtgggt gggggtccat ctttgggacc actgtcggca

    10561 gaggcatctt gaacgatagc ctttccttta tcgcaatgat ggcatttgta ggtgccacct

    10621 tccttttcta ctgtcctttt gatgaagtga cagatagctg ggcaatggaa tccgaggagg

    10681 tttcccgata ttaccctttg ttgaaaagtc tcaatagccc tttggtcttc tgagactgta

    10741 tctttgatat tcttggagta gacgagagtg tcgtgctcca ccatgtttgg caagctgctc

    10801 tagccaatac gcaaaccgcc tctccccgcg cgttggccga ttcattaatg cagctggcac

    10861 gacaggtttc ccgactggaa agcgggcagt gagcgcaacg caattaatgt gagttagctc

    10921 actcattagg caccccaggc tttacacttt atgcttccgg ctcgtatgtt gtgtggaatt

    10981 gtgagcggat aacaatttca cacaggaaac agctatgaca tgattacgaa ttcccgatct

    11041 agtaacatag atgacaccgc gcgcgataat ttatcctagt ttgcgcgcta tattttgttt

    11101 tctatcgcgt attaaatgta taattgcggg actctaatca taaaaaccca tctcataaat

    11161 aacgtcatgc attacatgtt aattattaca tgcttaacgt aattcaacag aaattatatg

    11221 ataatcatcg caagaccggc aacaggattc aatcttaaga aactttattg ccaaatgttt

    11281 gaacgatcgg ggaaattcga gctcattaca ttgatgagaa atattacgta catatacata

    11341 catccacgtc gatgcttaga agttacagca tgaaccaggg tttttattga acatgtcgaa

    11401 agcgtttata aaacataaac acacatttaa ttacggcaca ttcccaccgg ccgcctatat

    11461 attgatcgcg ccggtcaagt attttttttc ccaccttttc agcggacgcc gggtcgatta

    11521 gatggggatc gcgctggtga tccgcgacta gtatcgattg aaaatctcga aacagccgtg

    11581 tcatagtcaa tcattaggtg ttataggaac aatcaaaggt tttttcaagt gttaatcttc

    11641 atactaatat atacagtggg tactctttat ctactgccgt ggaactgtca tatttgatta

    11701 tgaaatttta gctctagaaa atatttgatc atcaatgtca agactttatg accttgcaaa

    11761 atacatttcc taattgagaa cagggtaaaa ttatgaacta tgcctctgaa ccttcataca

    11821 caggcagcac attttttgtt gtaaaattca tcttaatatc agcggaaaga ctggaccaga

    11881 gaaagaaaaa gttaagacag gcatatactc ttgatcctct aaaagagatg aggcggtaca

    11941 atgatcaacc atgaacatta aagtgatacg tggaacatga gaacacaaat aattgtcact

    12001 ggaacataag tacaaaaagg tttgtagtaa cttaccgcta gcagatctgt cgacctcgag

    12061 ggtacccggg gatcctctag agtcgacctg cagaagtaac accaaacaac agggtgagca

    12121 tcgacaaaag aaacagtacc aagcaaataa atagcgtatg aaggcagggc taaaaaaatc

    12181 cacatatagc tgctgcatat gccatcatcc aagtatatca agatcaaaat aattataaaa

    12241 catacttgtt tattataata gataggtact caaggttaga gcatatgaat agatgctgca

    12301 tatgccatca tgtatatgca tcagtaaaac ccacatcaac atgtatacct atcctagatc

    12361 gatatttcca tccatcttaa actcgtaact atgaagatgt atgacacaca catacagttc

    12421 caaaattaat aaatacacca ggtagtttga aacagtattc tactccgatc tagaacgaat

    12481 gaacgaccgc ccaaccacac cacatcatca caaccaagcg aacaaaaagc atctctgtat

    12541 atgcatcagt aaaacccgca tcaacatgta tacctatcct agatcgatat ttccatccat

    12601 catcttcaat tcgtaactat gaatatgtat ggcacacaca tacagatcca aaattaataa

    12661 atccaccagg tagtttgaaa cagaattcta ctccgatcta gaacgaccgc ccaaccagac

    12721 cacatcatca caaccaagac aaaaaaaagc atgaaaagat gacccgacaa acaagtgcac

    12781 ggcatatatt gaaataaagg aaaagggcaa accaaaccct atgcaacgaa acaaaaaaaa

    12841 tcatgaaatc gatcccgtct gcggaacggc tagagccatc ccaggattcc ccaaagagaa

    12901 acactggcaa gttagcaatc agaacgtgtc tgacgtacag gtcgcatccg tgtacgaacg

    12961 ctagcagcac ggatctaaca caaacacgga tctaacacaa acatgaacag aagtagaact

    13021 accgggccct aaccatggac cggaacgccg atctagagaa ggtagagagg gggggggggg

    13081 gaggacgagc ggcgtacctt gaagcggagg tgccgacggg tggatttggg ggagatctgg

    13141 ttgtgtgtgt gtgcgctccg aacaacacga ggttggggaa agagggtgtg gagggggtgt

    13201 ctatttatta cggcgggcga ggaagggaaa gcgaaggagc ggtgggaaag gaatcccccg

    13261 tagctgccgg tgccgtgaga ggaggaggag gccgcctgcc gtgccggctc acgtctgccg

    13321 ctccgccacg caatttctgg atgccgacag cggagcaagt ccaacggtgg agcggaactc

    13381 tcgagagggg tccagaggca gcgacagaga tgccgtgccg tctgcttcgc ttggcccgac

    13441 gcgacgctgc tggttcgctg gttggtgtcc gttagactcg tcgacggcgt ttaacaggct

    13501 ggcattatct actcgaaaca agaaaaatgt ttccttagtt tttttaattt cttaaagggt

    13561 atttgtttaa tttttagtca ctttatttta ttctatttta tatctaaatt attaaataaa

    13621 aaaactaaaa tagagtttta gttttcttaa tttagaggct aaaatagaat aaaatagatg

    13681 tactaaaaaa attagtctat aaaaaccatt aaccctaaac cctaaatgga tgtactaata

    13741 aaatggatga agtattatat aggtgaagct atttgcaaaa aaaaaggaga acacatgcac

    13801 actaaaaaga taaaactgta gagtcctgtt gtcaaaatac tcaattgtcc tttagaccat

    13861 gtctaactgt tcatttatat gattctctaa aacactgata ttattgtagt actatagatt

    13921 atattattcg tagagtaaag tttaaatata tgtataaaga tagataaact gcacttcaaa

    13981 caagtgtgac aaaaaaaata tgtggtaatt ttttataact tagacatgca atgctcatta

    14041 tctctagaga ggggcacgac cgggtcacgc tgcactgcag gcatgcaagc ttggcactgg

    14101 ccgtcgtttt acaacgtcgt gactgggaaa accctggcgt tacccaactt aatcgccttg

    14161 cagcacatcc ccctttcgcc agctggcgta atagcgaaga ggcccgcacc gatcgccctt

    14221 cccaacagtt gcgcagcctg aatggcgaat gctagagcag cttgagcttg gatcagattg

    14281 tcgtttcccg ccttcagttt agcttcatgg agtcaaagat tcaaatagag gacctaacag

    14341 aactcgccgt aaagactggc gaacagttca tacagagtct cttacgactc aatgacaaga

    14401 agaaaatctt cgtcaacatg gtggagcacg acacacttgt ctactccaaa aatatcaaag

    14461 atacagtctc agaagaccaa agggcaattg agacttttca acaaagggta atatccggaa

    14521 acctcctcgg attccattgc ccagctatct gtcactttat tgtgaagata gtggaaaagg

    14581 aaggtggctc ctacaaatgc catcattgcg ataaaggaaa ggccatcgtt gaagatgcct

    14641 ctgccgacag tggtcccaaa gatggacccc cacccacgag gagcatcgtg gaaaaagaag

    14701 acgttccaac cacgtcttca aagcaagtgg attgatgtga tatctccact gacgtaaggg

    14761 atgacgcaca atcccactat ccttcgcaag acccttcctc tatataagga agttcatttc

    14821 atttggagag aacacggggg actcttgacc atggta

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart