pTf16 Plasmid

$136.00

  • Model: PVT0805
  • 50 Units in Stock
Ask a question


Add to Cart:

pTf16

Search name

pTf16,Plasmid pTf16,pTf16 vector

 

pTf16 Information

Replicon: p15A ori
Plasmid classification: Escherichia coli vector; chaperone expression plasmid
Plasmid size: 5KB
Prokaryotic resistance: chloramphenicol Chl
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Inducement: Arabia sugar
Remarks: plasmids of chaperone

 

 

pTf16 Sequence

LOCUS       Exported                5015 bp ds-DNA     circular SYN 12-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 15
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5015)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Monday, September 12, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..5015
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      3624..4168
                     /direction=RIGHT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     promoter        4694..4796
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             4797..441
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
ORIGIN
        1 cgtatggcaa tgaaagacgg tgagctggtg atatgggata gtgttcaccc ttgttacacc
       61 gttttccatg agcaaactga aacgttttca tcgctctgga gtgaatacca cgacgatttc
      121 cggcagtttc tacacatata ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat
      181 ttccctaaag ggtttattga gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc
      241 accagttttg atttaaacgt ggccaatatg gacaacttct tcgcccccgt tttcaccatg
      301 ggcaaatatt atacgcaagg cgacaaggtg ctgatgccgc tggcgattca ggttcatcat
      361 gccgtctgtg atggcttcca tgtcggcaga atgcttaatg aattacaaca gtactgcgat
      421 gagtggcagg gcggggcgta atttttttaa ggcagttatt ggtgccctta aacgcctggt
      481 gctacgcctg aataagtgat aataagcgga tgaatggcag aaattcgaag aatagttacg
      541 gcttatgaca tctttgtgga cacatcattc actttttatt cacatccggc cctgaactcg
      601 ctaggacttg ccccggtgca ttttttaaat acccgcgaaa aatagagctg atcgtcaaat
      661 ccaacattgc gcccaacggt cgctatcggc attcgcgtag tgctaagcag aagtttcgcc
      721 tggctgatac gctgatcttc gcgccagctc aatacgctaa tgcctaactg ctggcggaac
      781 agatgtgata accgggaggg cgacaggcag acatgctggg cgacgctggc gatatcaaaa
      841 tggctgtccg ccagatggtc gctgatatac tggcaggcat cgcgcacacg gctatccatc
      901 ggcgggtgca acgactcatt aattaccgcc atacgtctga gcaacaactg ctccagcaga
      961 ttgatcgcca gtagctcaga atagcgacct tccccttgcc cggcgctgat gatctgcccg
     1021 aacagttcgc tgaaatgcgg ctggcgcgcc tcgtccgggc ggaaaaatcc tgtctgggca
     1081 aagattgtcg gccaggtcag ccactcctgc cagtaggcgc gaggccggaa ataaacccac
     1141 tggtgatacc actcgctggc gtccggatgc cgtccatagt gatgaatctc gcccggcgga
     1201 aacaataata tatcgccagg ccgacagaca aactgctcgc cattattatt aatgacgccc
     1261 tctccgcgga tggtcaggtt aagaatatat cccttcatgc ccaacggacg atcgataaaa
     1321 aaatccagat atccattcgc ttcaattggc gtcagcccgg cgaccagatg ggcattaaat
     1381 gaatatcccg gcaatagcgg atcattttgc gtttcagcca tgatttctct accccccgat
     1441 gttcagagaa gaaacaaatt gtccatatcg accaggacga cagagcttcc gtctccgcaa
     1501 gactttgcgc ttgatgaaag cacgtatcaa ccccgcttgt gaaaagcgct ttgtaacaaa
     1561 agcgtacagt tcaggcgata aaattaagta acagaagtgt ctataactat ggctggaatg
     1621 tccacattga atatttgcac agcgtcacac tttgcaaagc attagcattt ttgtccataa
     1681 gattagcgga tcctgcctga cggtttttgc cgcgactctc tataatttct ccatacctgt
     1741 ttttctggat ggagtaagac catggccttt cgggatgatt ctggtaacag ggaatgtgat
     1801 tgattataag aacatcccgg ttccgcgaag ccaacaacct gtgcttgcgg ggtaagagtt
     1861 gaccgagcac tgtgattttt tgaggtaaca agatgcaagt ttcagttgaa accactcaag
     1921 gccttggccg ccgtgtaacg attactatcg ctgctgacag catcgagacc gctgttaaaa
     1981 gcgagctggt caacgttgcg aaaaaagtac gtattgacgg cttccgcaaa ggcaaagtgc
     2041 caatgaatat cgttgctcag cgttatggcg cgtctgtacg ccaggacgtt ctgggtgacc
     2101 tgatgagccg taacttcatt gacgccatca ttaaagaaaa aatcaatccg gctggcgcac
     2161 cgacttatgt tccgggcgaa tacaagctgg gtgaagactt cacttactct gtagagtttg
     2221 aagtttatcc ggaagttgaa ctgcagggtc tggaagcgat cgaagttgaa aaaccgatcg
     2281 ttgaagtgac cgacgctgac gttgacggca tgctggatac tctgcgtaaa cagcaggcga
     2341 cctggaaaga aaaagacggc gctgttgaag cagaagaccg cgtaaccatc gacttcaccg
     2401 gttctgtaga cggcgaagag ttcgaaggcg gtaaagcgtc tgatttcgta ctggcgatgg
     2461 gccagggtcg tatgatcccg ggctttgaag acggtatcaa aggccacaaa gctggcgaag
     2521 agttcaccat cgacgtgacc ttcccggaag aataccacgc agaaaacctg aaaggtaaag
     2581 cagcgaaatt cgctatcaac ctgaagaaag ttgaagagcg tgaactgccg gaactgactg
     2641 cagaattcat caaacgtttc ggcgttgaag atggttccgt agaaggtctg cgcgctgaag
     2701 tgcgtaaaaa catggagcgc gagctgaaga gcgccatccg taaccgcgtt aagtctcagg
     2761 cgatcgaagg tctggtaaaa gctaacgaca tcgacgtacc ggctgcgctg atcgacagcg
     2821 aaatcgacgt tctgcgtcgc caggctgcac agcgtttcgg tggcaacgaa aaacaagctc
     2881 tggaactgcc gcgcgaactg ttcgaagaac aggctaaacg ccgcgtagtt gttggcctgc
     2941 tgctgggcga agttatccgc accaacgagc tgaaagctga cgaagagcgc gtgaaaggcc
     3001 tgatcgaaga gatggcttct gcgtacgaag atccgaaaga agttatcgag ttctacagca
     3061 aaaacaaaga actgatggac aacatgcgca atgttgctct ggaagaacag gctgttgaag
     3121 ctgtactggc gaaagcgaaa gtgactgaaa aagaaaccac tttcaacgag ctgatgaacc
     3181 agcaggcgta atttacgcag cataacgcgc taaattcgca caaaggcccg tcaccgccag
     3241 gtggtgggct tttttttgtc atgaattttg catggaaccg tgcgaaaagc ctctttcggt
     3301 gttagcgtaa caacaaaaga ttgttatgct tgaaatatgg tgatgccgta cccataacac
     3361 agggactagc tgataatccg tccataaggt tacaatcggt acagcaggtt ttttcaattt
     3421 tatccaggag acggaaatgt catacagcgg cgaacgagat aactttgcac cccatagatc
     3481 tggtaccaag cttatcgatg ataagctgtc aaacatgaga attacaactt atatcgtatg
     3541 gggctgactt caggtgctac atttgaagag ataaattgca ctgaaatcta gaaatatttt
     3601 atctgattaa taagatgatc ttcttgagat cgttttggtc tgcgcgtaat ctcttgctct
     3661 gaaaacgaaa aaaccgcctt gcagggcggt ttttcgaagg ttctctgagc taccaactct
     3721 ttgaaccgag gtaactggct tggaggagcg cagtcaccaa aacttgtcct ttcagtttag
     3781 ccttaaccgg cgcatgactt caagactaac tcctctaaat caattaccag tggctgctgc
     3841 cagtggtgct tttgcatgtc tttccgggtt ggactcaaga cgatagttac cggataaggc
     3901 gcagcggtcg gactgaacgg ggggttcgtg catacagtcc agcttggagc gaactgccta
     3961 cccggaactg agtgtcaggc gtggaatgag acaaacgcgg ccataacagc ggaatgacac
     4021 cggtaaaccg aaaggcagga acaggagagc gcacgaggga gccgccaggg gaaacgcctg
     4081 gtatctttat agtcctgtcg ggtttcgcca ccactgattt gagcgtcaga tttcgtgatg
     4141 cttgtcaggg gggcggagcc tatggaaaaa cggctttgcc gcggccctct cacttccctg
     4201 ttaagtatct tcctggcatc ttccaggaaa tctccgcccc gttcgtaagc catttccgct
     4261 cgccgcagtc gaacgaccga gcgtagcgag tcagtgagcg aggaagcgga atatatcctg
     4321 tatcacatat tctgctgacg caccggtgca

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart