pTrc99a

$166.00

  • Model: PVT0806
  • 49 Units in Stock
Ask a question


Add to Cart:

pTrc99a

PVT0806  2ug

 

pTrc99a Information

Promoter: Trc/lac
Replicon: pBR322 ori
Terminator: rrnB T2
Plasmid classification: Escherichia coli vector; pTrc series expression plasmid
Plasmid size: 4176bp
Prokaryotic resistance: ampicillin Amp
Cloned strain: Escherichia coli DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Inducement: IPTG or lactose and its analogues
5'sequencing primers: pTrcHis-F: GAGGTATATATTAATGTATCG
3'sequencing primers: pTrcHis-R:GATTTAATCTGTATCAGG
Remarks: pTrc expression plasmid

 

pTrc99a Description

PTrc99a is a pTrc series protein expression plasmid of Escherichia coli.

pTrc99a-Plasmid

pTrcHis-F and pTrcHis-R sites

pTrc99a Sequence

LOCUS       Exported                4176 bp ds-DNA    circular SYN 11-9-2015
KEYWORDS    Untitled
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4176)
  AUTHORS   admin
  TITLE     Direct Submission
  JOURNAL   Exported 2015-9-11  
FEATURES             Location/Qualifiers
     source          1..4176
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     misc_feature    193..222
                     /note="trc promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    230..246
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    270..326
                     /gene="
                     "
                     /note="MCS"
                     /note="pUC18/19 multiple cloning site"
     terminator      529..615
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      707..734
                     /note="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        754..845
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             846..1706
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      1877..2465
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    2651..2791
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     promoter        2977..3054
                     /gene="lacI (mutant)"
                     /note="lacIq promoter"
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             3055..4137
                     /codon_start=1
                     /gene="lacI"
                     /product="lac repressor"
                     /note="lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
                     YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
                     ALADSLMQLARQVSRLESGQ"
ORIGIN
        1 gtttgacagc ttatcatcga ctgcacggtg caccaatgct tctggcgtca ggcagccatc
       61 ggaagctgtg gtatggctgt gcaggtcgta aatcactgca taattcgtgt cgctcaaggc
      121 gcactcccgt tctggataat gttttttgcg ccgacatcat aacggttctg gcaaatattc
      181 tgaaatgagc tgttgacaat taatcatccg gctcgtataa tgtgtggaat tgtgagcgga
      241 taacaatttc acacaggaaa cagaccatgg aattcgagct cggtacccgg ggatcctcta
      301 gagtcgacct gcaggcatgc aagcttggct gttttggcgg atgagagaag attttcagcc
      361 tgatacagat taaatcagaa cgcagaagcg gtctgataaa acagaatttg cctggcggca
      421 gtagcgcggt ggtcccacct gaccccatgc cgaactcaga agtgaaacgc cgtagcgccg
      481 atggtagtgt ggggtctccc catgcgagag tagggaactg ccaggcatca aataaaacga
      541 aaggctcagt cgaaagactg ggcctttcgt tttatctgtt gtttgtcggt gaacgctctc
      601 ctgagtagga caaatccgcc gggagcggat ttgaacgttg cgaagcaacg gcccggaggg
      661 tggcgggcag gacgcccgcc ataaactgcc aggcatcaaa ttaagcagaa ggccatcctg
      721 acggatggcc tttttgcgtt tctacaaact ctttttgttt atttttctaa atacattcaa
      781 atatgtatcc gctcatgaga caataaccct gataaatgct tcaataatat tgaaaaagga
      841 agagtatgag tattcaacat ttccgtgtcg cccttattcc cttttttgcg gcattttgcc
      901 ttcctgtttt tgctcaccca gaaacgctgg tgaaagtaaa agatgctgaa gatcagttgg
      961 gtgcacgagt gggttacatc gaactggatc tcaacagcgg taagatcctt gagagttttc
     1021 gccccgaaga acgttttcca atgatgagca cttttaaagt tctgctatgt ggcgcggtat
     1081 tatcccgtgt tgacgccggg caagagcaac tcggtcgccg catacactat tctcagaatg
     1141 acttggttga gtactcacca gtcacagaaa agcatcttac ggatggcatg acagtaagag
     1201 aattatgcag tgctgccata accatgagtg ataacactgc ggccaactta cttctgacaa
     1261 cgatcggagg accgaaggag ctaaccgctt ttttgcacaa catgggggat catgtaactc
     1321 gccttgatcg ttgggaaccg gagctgaatg aagccatacc aaacgacgag cgtgacacca
     1381 cgatgcctac agcaatggca acaacgttgc gcaaactatt aactggcgaa ctacttactc
     1441 tagcttcccg gcaacaatta atagactgga tggaggcgga taaagttgca ggaccacttc
     1501 tgcgctcggc ccttccggct ggctggttta ttgctgataa atctggagcc ggtgagcgtg
     1561 ggtctcgcgg tatcattgca gcactggggc cagatggtaa gccctcccgt atcgtagtta
     1621 tctacacgac ggggagtcag gcaactatgg atgaacgaaa tagacagatc gctgagatag
     1681 gtgcctcact gattaagcat tggtaactgt cagaccaagt ttactcatat atactttaga
     1741 ttgatttaaa acttcatttt taatttaaaa ggatctaggt gaagatcctt tttgataatc
     1801 tcatgaccaa aatcccttaa cgtgagtttt cgttccactg agcgtcagac cccgtagaaa
     1861 agatcaaagg atcttcttga gatccttttt ttctgcgcgt aatctgctgc ttgcaaacaa
     1921 aaaaaccacc gctaccagcg gtggtttgtt tgccggatca agagctacca actctttttc
     1981 cgaaggtaac tggcttcagc agagcgcaga taccaaatac tgtccttcta gtgtagccgt
     2041 agttaggcca ccacttcaag aactctgtag caccgcctac atacctcgct ctgctaatcc
     2101 tgttaccagt ggctgctgcc agtggcgata agtcgtgtct taccgggttg gactcaagac
     2161 gatagttacc ggataaggcg cagcggtcgg gctgaacggg gggttcgtgc acacagccca
     2221 gcttggagcg aacgacctac accgaactga gatacctaca gcgtgagcta tgagaaagcg
     2281 ccacgcttcc cgaagggaga aaggcggaca ggtatccggt aagcggcagg gtcggaacag
     2341 gagagcgcac gagggagctt ccagggggaa acgcctggta tctttatagt cctgtcgggt
     2401 ttcgccacct ctgacttgag cgtcgatttt tgtgatgctc gtcagggggg cggagcctat
     2461 ggaaaaacgc cagcaacgcg gcctttttac ggttcctggc cttttgctgg ccttttgctc
     2521 acatgttctt tcctgcgtta tcccctgatt ctgtggataa ccgtattacc gcctttgagt
     2581 gagctgatac cgctcgccgc agccgaacga ccgagcgcag cgagtcagtg agcgaggaag
     2641 cggaagagcg cctgatgcgg tattttctcc ttacgcatct gtgcggtatt tcacaccgca
     2701 tatggtgcac tctcagtaca atctgctctg atgccgcata gttaagccag tatacactcc
     2761 gctatcgcta cgtgactggg tcatggctgc gccccgacac ccgccaacac ccgctgacgc
     2821 gccctgacgg gcttgtctgc tcccggcatc cgcttacaga caagctgtga ccgtctccgg
     2881 gagctgcatg tgtcagaggt tttcaccgtc atcaccgaaa cgcgcgaggc agcagatcaa
     2941 ttcgcgcgcg aaggcgaagc ggcatgcatt tacgttgaca ccatcgaatg gtgcaaaacc
     3001 tttcgcggta tggcatgata gcgcccggaa gagagtcaat tcagggtggt gaatgtgaaa
     3061 ccagtaacgt tatacgatgt cgcagagtat gccggtgtct cttatcagac cgtttcccgc
     3121 gtggtgaacc aggccagcca cgtttctgcg aaaacgcggg aaaaagtgga agcggcgatg
     3181 gcggagctga attacattcc caaccgcgtg gcacaacaac tggcgggcaa acagtcgttg
     3241 ctgattggcg ttgccacctc cagtctggcc ctgcacgcgc cgtcgcaaat tgtcgcggcg
     3301 attaaatctc gcgccgatca actgggtgcc agcgtggtgg tgtcgatggt agaacgaagc
     3361 ggcgtcgaag cctgtaaagc ggcggtgcac aatcttctcg cgcaacgcgt cagtgggctg
     3421 atcattaact atccgctgga tgaccaggat gccattgctg tggaagctgc ctgcactaat
     3481 gttccggcgt tatttcttga tgtctctgac cagacaccca tcaacagtat tattttctcc
     3541 catgaagacg gtacgcgact gggcgtggag catctggtcg cattgggtca ccagcaaatc
     3601 gcgctgttag cgggcccatt aagttctgtc tcggcgcgtc tgcgtctggc tggctggcat
     3661 aaatatctca ctcgcaatca aattcagccg atagcggaac gggaaggcga ctggagtgcc
     3721 atgtccggtt ttcaacaaac catgcaaatg ctgaatgagg gcatcgttcc cactgcgatg
     3781 ctggttgcca acgatcagat ggcgctgggc gcaatgcgcg ccattaccga gtccgggctg
     3841 cgcgttggtg cggatatctc ggtagtggga tacgacgata ccgaagacag ctcatgttat
     3901 atcccgccgt caaccaccat caaacaggat tttcgcctgc tggggcaaac cagcgtggac
     3961 cgcttgctgc aactctctca gggccaggcg gtgaagggca atcagctgtt gcccgtctca
     4021 ctggtgaaaa gaaaaaccac cctggcgccc aatacgcaaa ccgcctctcc ccgcgcgttg
     4081 gccgattcat taatgcagct ggcacgacag gtttcccgac tggaaagcgg gcagtgagcg
     4141 caacgcaatt aatgtgagtt agcgcgaatt gatctg
//

 

Caution:
Product is for research use only!

Search name

pTrc99a,Plasmid pTrc99a,pTrc99a vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart