pTRIPZ

$193.00

  • Model: PVT11114
  • 50 Units in Stock
Ask a question


Add to Cart:

pTRIPZ

Catalog No. PVT11114
Packing 2ug

 

pTRIPZ Information

Promoter: T7, Ubc

Replicator: pUC ori, F1 ori, SV40 ori

Terminator: SV40 poly (A) signal, bGH poly (A) signal

Plasmid classification: virus series, lentivirus interference carrier

Plasmid size: 13320bp

Prokaryotic resistance: Amp

Screening markers: Puro

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: T7:TAATACGACTCACTATAGGG

3'sequencing primers: primers designed according to sequence

 

pTRIPZ Description

pTRIPZ

 

pTRIPZ Sequence

LOCUS       Exported               13320 bp ds-DNA     circular SYN 13-JUL-2016

DEFINITION  Empty lentiviral vector for doxycycline-inducible expression of an 

            shRNAmir together with TurboRFP.

ACCESSION   .

VERSION     .

KEYWORDS    pTRIPZ

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 13320)

  AUTHORS   Open Biosystems

  TITLE     Direct Submission

  JOURNAL   Exported Friday, September 9, 2016 from SnapGene Viewer 3.1.4

COMMENT     Excision of rtTA3 using Cre recombinase or BamHI yields a vector 

            that can be used for Tet-repressible expression.

FEATURES             Location/Qualifiers

     source          1..13320

                     /organism="synthetic DNA construct"

                     /lab_host="Mammalian Cells"

                     /mol_type="other DNA"

     LTR             1..634

                     /note="5' LTR"

                     /note="5' long terminal repeat (LTR) from HIV-1"

     misc_feature    681..806

                     /note="HIV-1 psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1303..1536

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    2063..2180

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     CDS             complement(2245..2619)

                     /codon_start=1

                     /gene="Sh ble from Streptoalloteichus hindustanus"

                     /product="antibiotic-binding protein"

                     /note="BleoR"

                     /note="confers resistance to bleomycin, phleomycin, and 

                     Zeocin(TM)"

                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD

                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR

                     EFALRDPAGNCVHFVAEEQD"

     promoter        complement(2639..2686)

                     /note="EM7 promoter"

                     /note="synthetic bacterial promoter "

     protein_bind    2722..2740

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2757..2775

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2793..2811

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2829..2847

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2864..2882

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2900..2918

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     promoter        2930..2968

                     /note="minimal CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     CDS             3005..3700

                     /codon_start=1

                     /product="red fluorescent protein from Entacmaea 

                     quadricolor"

                     /note="TurboRFP"

                     /note="mammalian codon-optimized"

                     /translation="MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMKIKV

                     VEGGPLPFAFDILATSFMYGSKAFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTA

                     TQDTSFQNGCIIYNVKINGVNFPSNGPVMQKKTRGWEANTEMLYPADGGLRGHSQMALK

                     LVGGGYLHCSFKTTYRSKKPAKNLKMPGFHFVDHRLERIKEADKETYVEQHEMAVAKYC

                     DLPSKLGHR"

     misc_feature    3806..4064

                     /note="shRNAmir insertion site"

                     /note="A fragment encoding a microRNA-adapted shRNA can be 

                     inserted between the XhoI and MluI sites."

     promoter        4070..5281

                     /note="UbC promoter"

                     /note="human ubiquitin C promoter"

     protein_bind    5294..5327

                     /bound_moiety="Cre recombinase"

                     /note="loxP511"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GTATACAT). loxP511 sites are compatible with each

                     other, but incompatible with wild-type loxP sites."

     CDS             5334..6041

                     /codon_start=1

                     /product="reverse tetracycline transactivator 3"

                     /note="rtTA3"

                     /note="activates expression from Tet-responsive promoters 

                     in the presence of doxycycline"

                     /translation="MSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHV

                     KNKRALLDALPIEMLDRHHTHFCPLEGESWQDFLRNNAKSYRCALLSHRDGAKVHLGTR

                     PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEEQEHQVAKEERETPTT

                     DSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPTDALDDFDLDMLPA

                     DALDDFDLDMLPG"

     protein_bind    6042..6075

                     /bound_moiety="Cre recombinase"

                     /note="loxP511"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GTATACAT). loxP511 sites are compatible with each

                     other, but incompatible with wild-type loxP sites."

     misc_feature    6098..6666

                     /note="IRES"

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     CDS             6673..7275

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /note="PuroR"

                     /note="confers resistance to puromycin"

                     /translation="MATEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIE

                     RVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGSRMAELSGSRL

                     AAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLET

                     SAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     misc_feature    7291..7879

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     LTR             8086..8319

                     /note="3' LTR (Delta-U3)"

                     /note="self-inactivating 3' long terminal repeat (LTR) from

                     HIV-1"

     polyA_signal    8426..8650

                     /note="bGH poly(A) signal"

                     /note="bovine growth hormone polyadenylation signal"

     rep_origin      8696..9124

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        9138..9467

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      9318..9453

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             9516..10545

                     /note="HygR (inactivated)"

                     /note="The hygromycin resistance gene was inactivated by 

                     destroying an EcoRI site within the coding sequence."

     polyA_signal    10675..10796

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(11247..11835)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(12006..12866)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(12867..12971)

                     /gene="bla"

                     /note="AmpR promoter"

     polyA_signal    13019..13153

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

ORIGIN

        1 tggaagggct aattcactcc caaagaagac aagatatcct tgatctgtgg atctaccaca

       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccaggggtc agatatccac

      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agataaggta gaagaggcca

      181 ataaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatgggatg gatgacccgg

      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac gtggcccgag

      301 agctgcatcc ggagtacttc aagaactgct gatatcgagc ttgctacaag ggactttccg

      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat

      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga

      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct

      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc

      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacttgaaag

      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg

      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga

      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgcgatggg

      841 aaaaaattcg gttaaggcca gggggaaaga aaaaatataa attaaaacat atagtatggg

      901 caagcaggga gctagaacga ttcgcagtta atcctggcct gttagaaaca tcagaaggct

      961 gtagacaaat actgggacag ctacaaccat cccttcagac aggatcagaa gaacttagat

     1021 cattatataa tacagtagca accctctatt gtgtgcatca aaggatagag ataaaagaca

     1081 ccaaggaagc tttagacaag atagaggaag agcaaaacaa aagtaagacc accgcacagc

     1141 aagcggccgg ccgctgatct tcagacctgg aggaggagat atgagggaca attggagaag

     1201 tgaattatat aaatataaag tagtaaaaat tgaaccatta ggagtagcac ccaccaaggc

     1261 aaagagaaga gtggtgcaga gagaaaaaag agcagtggga ataggagctt tgttccttgg

     1321 gttcttggga gcagcaggaa gcactatggg cgcagcgtca atgacgctga cggtacaggc

     1381 cagacaatta ttgtctggta tagtgcagca gcagaacaat ttgctgaggg ctattgaggc

     1441 gcaacagcat ctgttgcaac tcacagtctg gggcatcaag cagctccagg caagaatcct

     1501 ggctgtggaa agatacctaa aggatcaaca gctcctgggg atttggggtt gctctggaaa

     1561 actcatttgc accactgctg tgccttggaa tgctagttgg agtaataaat ctctggaaca

     1621 gatttggaat cacacgacct ggatggagtg ggacagagaa attaacaatt acacaagctt

     1681 aatacactcc ttaattgaag aatcgcaaaa ccagcaagaa aagaatgaac aagaattatt

     1741 ggaattagat aaatgggcaa gtttgtggaa ttggtttaac ataacaaatt ggctgtggta

     1801 tataaaatta ttcataatga tagtaggagg cttggtaggt ttaagaatag tttttgctgt

     1861 actttctata gtgaatagag ttaggcaggg atattcacca ttatcgtttc agacccacct

     1921 cccaaccccg aggggacccg acaggcccga aggaatagaa gaagaaggtg gagagagaga

     1981 cagagacaga tccattcgat tagtgaacgg atcggcactg cgtgcgccaa ttctgcagac

     2041 aaatggcagt attcatccac aattttaaaa gaaaaggggg gattgggggg tacagtgcag

     2101 gggaaagaat agtagacata atagcaacag acatacaaac taaagaatta caaaaacaaa

     2161 ttacaaaaat tcaaaatttt cgggtttatt acagggacag cagagatcca gtttggttag

     2221 taccgggccc gctctagtcc ggaatcagtc ctgctcctcg gccacgaagt gcacgcagtt

     2281 gccggccggg tcgcgcaggg cgaactcccg cccccacggc tgctcgccga tctcggtcat

     2341 ggccggcccg gaggcgtccc ggaagttcgt ggacacgacc tccgaccact cggcgtacag

     2401 ctcgtccagg ccgcgcaccc acacccaggc cagggtgttg tccggcacca cctggtcctg

     2461 gaccgcgctg atgaacaggg tcacgtcgtc ccggaccaca ccggcgaagt cgtcctccac

     2521 gaagtcccgg gagaacccga gccggtcggt ccagaactcg accgctccgg cgacgtcgcg

     2581 cgcggtgagc accggaacgg cactggtcaa cttggccatg gtggccctcc tatagtgagt

     2641 cgtattatac tatgccgata tactatgccg atgattaatt gtcaacacgt gctgcaggtc

     2701 cgaggttcta gacgagttta ctccctatca gtgatagaga acgatgtcga gtttactccc

     2761 tatcagtgat agagaacgta tgtcgagttt actccctatc agtgatagag aacgtatgtc

     2821 gagtttactc cctatcagtg atagagaacg tatgtcgagt ttatccctat cagtgataga

     2881 gaacgtatgt cgagtttact ccctatcagt gatagagaac gtatgtcgag gtaggcgtgt

     2941 acggtgggag gcctatataa gcagagctcg tttagtgaac cgtcagatcg caccggtcgc

     3001 caccatgagc gagctgatca aggagaacat gcacatgaag ctgtacatgg agggcaccgt

     3061 gaacaaccac cacttcaagt gcacatccga gggcgaaggc aagccctacg agggcaccca

     3121 gaccatgaag atcaaggtgg tcgagggcgg ccctctcccc ttcgccttcg acatcctggc

     3181 taccagcttc atgtacggca gcaaagcctt catcaaccac acccagggca tccccgactt

     3241 ctttaagcag tccttccctg agggcttcac atgggagaga atcaccacat acgaagacgg

     3301 gggcgtgctg accgctaccc aggacaccag cttccagaac ggctgcatca tctacaacgt

     3361 caagatcaac ggggtgaact tcccatccaa cggccctgtg atgcagaaga aaacacgcgg

     3421 ctgggaggcc aacaccgaga tgctgtaccc cgctgacggc ggcctgagag gccacagcca

     3481 gatggccctg aagctcgtgg gcgggggcta cctgcactgc tccttcaaga ccacatacag

     3541 atccaagaaa cccgctaaga acctcaagat gcccggcttc cacttcgtgg accacagact

     3601 ggaaagaatc aaggaggccg acaaagagac ctacgtcgag cagcacgaga tggctgtggc

     3661 caagtactgc gacctcccta gcaaactggg gcacagataa tcgatagttt gtttgaatga

     3721 ggcttcagta ctttacagaa tcgttgcctg cacatcttgg aaacacttgc tgggattact

     3781 tcttcaggtt aacccaacag aaggctcgag gtaaccggat cctgatcaga attcaagggg

     3841 ctactttagg agcaattatc ttgtttacta aaactgaata ccttgctatc tctttgatac

     3901 atttttacaa agctgaatta aaatggtata aattaaatca cttttttcaa ttggaagact

     3961 aatgcggccg gccattactc cgtctcgtgt cttgttgcat atgtctgctg gtttgtttga

     4021 tgttgtttgc gggcgggccc tatagtgagt cgtattacct aggacgcgtg gcctccgcgc

     4081 cgggttttgg cgcctcccgc gggcgccccc ctcctcacgg cgagcgctgc cacgtcagac

     4141 gaagggcgca gcgagcgtcc tgatccttcc gcccggacgc tcaggacagc ggcccgctgc

     4201 tcataagact cggccttaga accccagtat cagcagaagg acattttagg acgggacttg

     4261 ggtgactcta gggcactggt tttctttcca gagagcggaa caggcgagga aaagtagtcc

     4321 cttctcggcg attctgcgga gggatctccg tggggcggtg aacgccgatg attatataag

     4381 gacgcgccgg gtgtggcaca gctagttccg tcgcagccgg gatttgggtc gcggttcttg

     4441 tttgtggatc gctgtgatcg tcacttggtg agtagcgggc tgctgggctg gccggggctt

     4501 tcgtggccgc cgggccgctc ggtgggacgg aagcgtgtgg agagaccgcc aagggctgta

     4561 gtctgggtcc gcgagcaagg ttgccctgaa ctgggggttg gggggagcgc agcaaaatgg

     4621 cggctgttcc cgagtcttga atggaagacg cttgtgaggc gggctgtgag gtcgttgaaa

     4681 caaggtgggg ggcatggtgg gcggcaagaa cccaaggtct tgaggccttc gctaatgcgg

     4741 gaaagctctt attcgggtga gatgggctgg ggcaccatct ggggaccctg acgtgaagtt

     4801 tgtcactgac tggagaactc ggtttgtcgt ctgttgcggg ggcggcagtt atggcggtgc

     4861 cgttgggcag tgcacccgta cctttgggag cgcgcgccct cgtcgtgtcg tgacgtcacc

     4921 cgttctgttg gcttataatg cagggtgggg ccacctgccg gtaggtgtgc ggtaggcttt

     4981 tctccgtcgc aggacgcagg gttcgggcct agggtaggct ctcctgaatc gacaggcgcc

     5041 ggacctctgg tgaggggagg gataagtgag gcgtcagttt ctttggtcgg ttttatgtac

     5101 ctatcttctt aagtagctga agctccggtt ttgaactatg cgctcggggt tggcgagtgt

     5161 gttttgtgaa gttttttagg caccttttga aatgtaatca tttgggtcaa tatgtaattt

     5221 tcagtgttag actagtaaat tgtccgctaa attctggccg tttttggctt ttttgttaga

     5281 cgctagcgga tccataactt cgtatagtat acattatacg aagttatgcc accatgtcta

     5341 ggctggacaa gagcaaagtc ataaacggag ctctggaatt actcaatggt gtcggtatcg

     5401 aaggcctgac gacaaggaaa ctcgctcaaa agctgggagt tgagcagcct accctgtact

     5461 ggcacgtgaa gaacaagcgg gccctgctcg atgccctgcc aatcgagatg ctggacaggc

     5521 atcataccca cttctgcccc ctggaaggcg agtcatggca agactttctg cggaacaacg

     5581 ccaagtcata ccgctgtgct ctcctctcac atcgcgacgg ggctaaagtg catctcggca

     5641 cccgcccaac agagaaacag tacgaaaccc tggaaaatca gctcgcgttc ctgtgtcagc

     5701 aaggcttctc cctggagaac gcactgtacg ctctgtccgc cgtgggccac tttacactgg

     5761 gctgcgtatt ggaggaacag gagcatcaag tagcaaaaga ggaaagagag acacctacca

     5821 ccgattctat gcccccactt ctgagacaag caattgagct gttcgaccgg cagggagccg

     5881 aacctgcctt ccttttcggc ctggaactaa tcatatgtgg cctggagaaa cagctaaagt

     5941 gcgaaagcgg cgggccgacc gacgcccttg acgattttga cttagacatg ctcccagccg

     6001 atgcccttga cgattttgac cttgacatgc tccccgggta aataacttcg tatagtatac

     6061 attatacgaa gttatggatc cgcggccgca aattccgccc ctctccctcc ccccccccta

     6121 acgttactgg ccgaagccgc ttggaataag gccggtgtgc gtttgtctat atgttatttt

     6181 ccaccatatt gccgtctttt ggcaatgtga gggcccggaa acctggccct gtcttcttga

     6241 cgagcattcc taggggtctt tcccctctcg ccaaaggaat gcaaggtctg ttgaatgtcg

     6301 tgaaggaagc agttcctctg gaagcttctt gaagacaaac aacgtctgta gcgacccttt

     6361 gcaggcagcg gaacccccca cctggcgaca ggtgcctctg cggccaaaag ccacgtgtat

     6421 aagatacacc tgcaaaggcg gcacaacccc agtgccacgt tgtgagttgg atagttgtgg

     6481 aaagagtcaa atggctctcc tcaagcgtat tcaacaaggg gctgaaggat gcccagaagg

     6541 taccccattg tatgggatct gatctggggc ctcggtgcac atgctttaca tgtgtttagt

     6601 cgaggttaaa aaaacgtcta ggccccccga accacgggga cgtggttttc ctttgaaaaa

     6661 cacgataata ccatggccac cgagtacaag cccacggtgc gcctcgccac ccgcgacgac

     6721 gtcccccggg ccgtacgcac cctcgccgcc gcgttcgccg actaccccgc cacgcgccac

     6781 accgtcgacc cggaccgcca catcgagcgg gtcaccgagc tgcaagaact cttcctcacg

     6841 cgcgtcgggc tcgacatcgg caaggtgtgg gtcgcggacg acggcgccgc ggtggcggtc

     6901 tggaccacgc cggagagcgt cgaagcgggg gcggtgttcg ccgagatcgg ctcgcgcatg

     6961 gccgagttga gcggttcccg gctggccgcg cagcaacaga tggaaggcct cctggcgccg

     7021 caccggccca aggagcccgc gtggttcctg gccaccgtcg gcgtctcgcc cgaccaccag

     7081 ggcaagggtc tgggcagcgc cgtcgtgctc cccggagtgg aggcggccga gcgcgctggg

     7141 gtgcccgcct tcctggagac ctccgcgccc cgcaacctcc ccttctacga gcggctcggc

     7201 ttcaccgtca ccgccgacgt cgaggtgccc gaaggaccgc gcacctggtg catgacccgc

     7261 aagcccggtg cctgagttcg cgtctggaac aatcaacctc tggattacaa aatttgtgaa

     7321 agattgactg gtattcttaa ctatgttgct ccttttacgc tatgtggata cgctgcttta

     7381 atgcctttgt atcatgctat tgcttcccgt atggctttca ttttctcctc cttgtataaa

     7441 tcctggttgc tgtctcttta tgaggagttg tggcccgttg tcaggcaacg tggcgtggtg

     7501 tgcactgtgt ttgctgacgc aacccccact ggttggggca ttgccaccac ctgtcagctc

     7561 ctttccggga ctttcgcttt ccccctccct attgccacgg cggaactcat cgccgcctgc

     7621 cttgcccgct gctggacagg ggctcggctg ttgggcactg acaattccgt ggtgttgtcg

     7681 gggaagctga cgtcctttcc atggctgctc gcctgtgttg ccacctggat tctgcgcggg

     7741 acgtccttct gctacgtccc ttcggccctc aatccagcgg accttccttc ccgcggcctg

     7801 ctgccggctc tgcggcctct tccgcgtctt cgccttcgcc ctcagacgag tcggatctcc

     7861 ctttgggccg cctccccgcc tggaattaat tctgcagtcg agacctagaa aaacatggag

     7921 caatcacaag tagcaataca gcagctacca atgctgattg tgcctggcta gaagcacaag

     7981 aggaggagga ggtgggtttt ccagtcacac ctcaggtacc tttaagacca atgacttaca

     8041 aggcagctgt agatcttagc cactttttaa aagaaaagag gggactggaa gggctaattc

     8101 actcccaacg aagacaagat ctgctttttg cttgtactgg gtctctctgg ttagaccaga

     8161 tctgagcctg ggagctctct ggctaactag ggaacccact gcttaagcct caataaagct

     8221 tgccttgagt gcttcaagta gtgtgtgccc gtctgttgtg tgactctggt aactagagat

     8281 ccctcagacc cttttagtca gtgtggaaaa tctctagcag tagtagttca tgtcatctta

     8341 ttattcagta tttataactt gcaaagaaat gaatatcaga gagtgagagg ccttgacatt

     8401 gtttaaaccc gctgatcagc ctcgactgtg ccttctagtt gccagccatc tgttgtttgc

     8461 ccctcccccg tgccttcctt gaccctggaa ggtgccactc ccactgtcct ttcctaataa

     8521 aatgaggaaa ttgcatcgca ttgtctgagt aggtgtcatt ctattctggg gggtggggtg

     8581 gggcaggaca gcaaggggga ggattgggaa gacaatagca ggcatgctgg ggatgcggtg

     8641 ggctctatgg cttctgaggc ggaaagaacc agctggggct ctagggggta tccccacgcg

     8701 ccctgtagcg gcgcattaag cgcggcgggt gtggtggtta cgcgcagcgt gaccgctaca

     8761 cttgccagcg ccctagcgcc cgctcctttc gctttcttcc cttcctttct cgccacgttc

     8821 gccggctttc cccgtcaagc tctaaatcgg gggctccctt tagggttccg atttagtgct

     8881 ttacggcacc tcgaccccaa aaaacttgat tagggtgatg gttcacgtag tgggccatcg

     8941 ccctgataga cggtttttcg ccctttgacg ttggagtcca cgttctttaa tagtggactc

     9001 ttgttccaaa ctggaacaac actcaaccct atctcggtct attcttttga tttataaggg

     9061 attttgccga tttcggccta ttggttaaaa aatgagctga tttaacaaaa atttaacgcg

     9121 aattaattct gtggaatgtg tgtcagttag ggtgtggaaa gtccccaggc tccccagcag

     9181 gcagaagtat gcaaagcatg catctcaatt agtcagcaac caggtgtgga aagtccccag

     9241 gctccccagc aggcagaagt atgcaaagca tgcatctcaa ttagtcagca accatagtcc

     9301 cgcccctaac tccgcccatc ccgcccctaa ctccgcccag ttccgcccat tctccgcccc

     9361 atggctgact aatttttttt atttatgcag aggccgaggc cgcctctgcc tctgagctat

     9421 tccagaagta gtgaggaggc ttttttggag gcctaggctt ttgcaaaaag ctcccgggag

     9481 cttgtatatc cattttcgga tctgatcagc acgtgatgaa aaagcctgaa ctcaccgcga

     9541 cgtctgtcga gaagtttctg atcgaaaagt tcgacagcgt ctccgacctg atgcagctct

     9601 cggagggcga agaatctcgt gctttcagct tcgatgtagg agggcgtgga tatgtcctgc

     9661 gggtaaatag ctgcgccgat ggtttctaca aagatcgtta tgtttatcgg cactttgcat

     9721 cggccgcgct cccgattccg gaagtgcttg acattgggga attaattcag cgagagcctg

     9781 acctattgca tctcccgccg tgcacagggt gtcacgttgc aagacctgcc tgaaaccgaa

     9841 ctgcccgctg ttctgcagcc ggtcgcggag gccatggatg cgatcgctgc ggccgatctt

     9901 agccagacga gcgggttcgg cccattcgga ccgcaaggaa tcggtcaata cactacatgg

     9961 cgtgatttca tatgcgcgat tgctgatccc catgtgtatc actggcaaac tgtgatggac

    10021 gacaccgtca gtgcgtccgt cgcgcaggct ctcgatgagc tgatgctttg ggccgaggac

    10081 tgccccgaag tccggcacct cgtgcacgcg gatttcggct ccaacaatgt cctgacggac

    10141 aatggccgca taacagcggt cattgactgg agcgaggcga tgttcgggga ttcccaatac

    10201 gaggtcgcca acatcttctt ctggaggccg tggttggctt gtatggagca gcagacgcgc

    10261 tacttcgagc ggaggcatcc ggagcttgca ggatcgccgc ggctccgggc gtatatgctc

    10321 cgcattggtc ttgaccaact ctatcagagc ttggttgacg gcaatttcga tgatgcagct

    10381 tgggcgcagg gtcgatgcga cgcaatcgtc cgatccggag ccgggactgt cgggcgtaca

    10441 caaatcgccc gcagaagcgc ggccgtctgg accgatggct gtgtagaagt actcgccgat

    10501 agtggaaacc gacgccccag cactcgtccg agggcaaagg aatagcacgt gctacgagat

    10561 ttcgattcca ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc

    10621 ggctggatga tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg

    10681 tttattgcag cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa

    10741 gcattttttt cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat

    10801 gtctgtatac cgtcgacctc tagctagagc ttggcgtaat catggtcata gctgtttcct

    10861 gtgtgaaatt gttatccgct cacaattcca cacaacatac gagccggaag cataaagtgt

    10921 aaagcctggg gtgcctaatg agtgagctaa ctcacattaa ttgcgttgcg ctcactgccc

    10981 gctttccagt cgggaaacct gtcgtgccag ctgcattaat gaatcggcca acgcgcgggg

    11041 agaggcggtt tgcgtattgg gcgctcttcc gcttcctcgc tcactgactc gctgcgctcg

    11101 gtcgttcggc tgcggcgagc ggtatcagct cactcaaagg cggtaatacg gttatccaca

    11161 gaatcagggg ataacgcagg aaagaacatg tgagcaaaag gccagcaaaa ggccaggaac

    11221 cgtaaaaagg ccgcgttgct ggcgtttttc cataggctcc gcccccctga cgagcatcac

    11281 aaaaatcgac gctcaagtca gaggtggcga aacccgacag gactataaag ataccaggcg

    11341 tttccccctg gaagctccct cgtgcgctct cctgttccga ccctgccgct taccggatac

    11401 ctgtccgcct ttctcccttc gggaagcgtg gcgctttctc atagctcacg ctgtaggtat

    11461 ctcagttcgg tgtaggtcgt tcgctccaag ctgggctgtg tgcacgaacc ccccgttcag

    11521 cccgaccgct gcgccttatc cggtaactat cgtcttgagt ccaacccggt aagacacgac

    11581 ttatcgccac tggcagcagc cactggtaac aggattagca gagcgaggta tgtaggcggt

    11641 gctacagagt tcttgaagtg gtggcctaac tacggctaca ctagaagaac agtatttggt

    11701 atctgcgctc tgctgaagcc agttaccttc ggaaaaagag ttggtagctc ttgatccggc

    11761 aaacaaacca ccgctggtag cggtggtttt tttgtttgca agcagcagat tacgcgcaga

    11821 aaaaaaggat ctcaagaaga tcctttgatc ttttctacgg ggtctgacgc tcagtggaac

    11881 gaaaactcac gttaagggat tttggtcatg agattatcaa aaaggatctt cacctagatc

    11941 cttttaaatt aaaaatgaag ttttaaatca atctaaagta tatatgagta aacttggtct

    12001 gacagttacc aatgcttaat cagtgaggca cctatctcag cgatctgtct atttcgttca

    12061 tccatagttg cctgactccc cgtcgtgtag ataactacga tacgggaggg cttaccatct

    12121 ggccccagtg ctgcaatgat accgcgagac ccacgctcac cggctccaga tttatcagca

    12181 ataaaccagc cagccggaag ggccgagcgc agaagtggtc ctgcaacttt atccgcctcc

    12241 atccagtcta ttaattgttg ccgggaagct agagtaagta gttcgccagt taatagtttg

    12301 cgcaacgttg ttgccattgc tacaggcatc gtggtgtcac gctcgtcgtt tggtatggct

    12361 tcattcagct ccggttccca acgatcaagg cgagttacat gatcccccat gttgtgcaaa

    12421 aaagcggtta gctccttcgg tcctccgatc gttgtcagaa gtaagttggc cgcagtgtta

    12481 tcactcatgg ttatggcagc actgcataat tctcttactg tcatgccatc cgtaagatgc

    12541 ttttctgtga ctggtgagta ctcaaccaag tcattctgag aatagtgtat gcggcgaccg

    12601 agttgctctt gcccggcgtc aatacgggat aataccgcgc cacatagcag aactttaaaa

    12661 gtgctcatca ttggaaaacg ttcttcgggg cgaaaactct caaggatctt accgctgttg

    12721 agatccagtt cgatgtaacc cactcgtgca cccaactgat cttcagcatc ttttactttc

    12781 accagcgttt ctgggtgagc aaaaacagga aggcaaaatg ccgcaaaaaa gggaataagg

    12841 gcgacacgga aatgttgaat actcatactc ttcctttttc aatattattg aagcatttat

    12901 cagggttatt gtctcatgag cggatacata tttgaatgta tttagaaaaa taaacaaata

    12961 ggggttccgc gcacatttcc ccgaaaagtg ccacctgacg tcgacggatc gggagatcaa

    13021 cttgtttatt gcagcttata atggttacaa ataaagcaat agcatcacaa atttcacaaa

    13081 taaagcattt ttttcactgc attctagttg tggtttgtcc aaactcatca atgtatctta

    13141 tcatgtctgg atcaactgga taactcaagc taaccaaaat catcccaaac ttcccacccc

    13201 ataccctatt accactgcca attacctgtg gtttcattta ctctaaacct gtgattcctc

    13261 tgaattattt tcattttaaa gaaattgtat ttgttaaata tgtactacaa acttagtagt

//

Caution:

Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart