pttq18

$193.00

  • Model: PVT10669
  • 50 Units in Stock
Ask a question


Add to Cart:

pttq18

PVT10669    2ug
 

pttq18 Description

Pttq18 is a large intestine expression plasmid.

 

pttq18 Information

Resistance Amp
Strain DH5alpha
Culture temperature 37degrees centigrade

 

pttq18 Sequence

LOCUS       Exported                4563 bp ds-DNA     circular SYN 26-APR-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pttq18

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4563)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 28, 2017

FEATURES             Location/Qualifiers

     source          1..4563

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      897..1485

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     promoter        1927..1955

                     /label=tac promoter

                     /note="strong E. coli promoter; hybrid between the trp and 

                     lac UV5 promoters"

     protein_bind    1963..1979

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     CDS             1999..2322

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /label=lacZ-alpha

                     /translation="MNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH

                     PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRINSLFWRMREDFQP

                     DTD"

     misc_feature    2001..2057

                     /label=MCS

                     /note="pUC18/19 multiple cloning site"

     primer_bind     complement(2061..2077)

                     /label=M13 fwd

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     terminator      2478..2564

                     /gene="Escherichia coli rrnB"

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      2656..2683

                     /label=rrnB T2 terminator

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     promoter        3051..3128

                     /gene="lacI (mutant)"

                     /label=lacIq promoter

                     /note="In the lacIq allele, a single base change in the 

                     promoter boosts expression of the lacI gene about 10-fold."

     CDS             3129..4211

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /label=lacI

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     promoter        4324..4428

                     /gene="bla"

                     /label=AmpR promoter

     CDS             4429..726

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

ORIGIN

        1 gaactggatc tcaacagcgg taagatcctt gagagttttc gccccgaaga acgttttcca

       61 atgatgagca cttttaaagt tctgctatgt ggcgcggtat tatcccgtat tgacgccggg

      121 caagagcaac tcggtcgccg catacactat tctcagaatg acttggttga gtactcacca

      181 gtcacagaaa agcatcttac ggatggcatg acagtaagag aattatgcag tgctgccata

      241 accatgagtg ataacactgc ggccaactta cttctgacaa cgatcggagg accgaaggag

      301 ctaaccgctt ttttgcacaa catgggggat catgtaactc gccttgatcg ttgggaaccg

      361 gagctgaatg aagccatacc aaacgacgag cgtgacacca cgatgcctgt agcaatggca

      421 acaacgttgc gcaaactatt aactggcgaa ctacttactc tagcttcccg gcaacaatta

      481 atagactgga tggaggcgga taaagttgca ggaccacttc tgcgctcggc ccttccggct

      541 ggctggttta ttgctgataa atctggagcc ggtgagcgtg ggtctcgcgg tatcattgca

      601 gcactggggc cagatggtaa gccctcccgt atcgtagtta tctacacgac ggggagtcag

      661 gcaactatgg atgaacgaaa tagacagatc gctgagatag gtgcctcact gattaagcat

      721 tggtaactgt cagaccaagt ttactcatat atactttaga ttgatttaaa acttcatttt

      781 taatttaaaa ggatctaggt gaagatcctt tttgataatc tcatgaccaa aatcccttaa

      841 cgtgagtttt cgttccactg agcgtcagac cccgtagaaa agatcaaagg atcttcttga

      901 gatccttttt ttctgcgcgt aatctgctgc ttgcaaacaa aaaaaccacc gctaccagcg

      961 gtggtttgtt tgccggatca agagctacca actctttttc cgaaggtaac tggcttcagc

     1021 agagcgcaga taccaaatac tgtccttcta gtgtagccgt agttaggcca ccacttcaag

     1081 aactctgtag caccgcctac atacctcgct ctgctaatcc tgttaccagt ggctgctgcc

     1141 agtggcgata agtcgtgtct taccgggttg gactcaagac gatagttacc ggataaggcg

     1201 cagcggtcgg gctgaacggg gggttcgtgc acacagccca gcttggagcg aacgacctac

     1261 accgaactga gatacctaca gcgtgagcta tgagaaagcg ccacgcttcc cgaagggaga

     1321 aaggcggaca ggtatccggt aagcggcagg gtcggaacag gagagcgcac gagggagctt

     1381 ccagggggaa acgcctggta tctttatagt cctgtcgggt ttcgccacct ctgacttgag

     1441 cgtcgatttt tgtgatgctc gtcagggggg cggagcctat ggaaaaacgc cagcaacgcg

     1501 gcctttttac ggttcctggc cttttgctgg ccttttgctc acatgttctt tcctgcgtta

     1561 tcccctgatt ctgtggataa ccgtattacc gcctttgagt gagctgatac cgctcgccgc

     1621 agccgaacga ccgagcgcag cgagtcagtg agcgaggaag cggaagagcg cccaatacgc

     1681 aaaccgcctc tccccgcgcg ttggccgatt cattaatgca gaattaattc tcatgtttga

     1741 cagcttatca tcgactgcac ggtgcaccaa tgcttctggc gtcaggcagc catcggaagc

     1801 tgtggtatgg ctgtgcaggt cgtaaatcac tgcataattc gtgtcgctca aggcgcactc

     1861 ccgttctgga taatgttttt tgcgccgaca tcataacggt tctggcaaat attctgaaat

     1921 gagctgttga caattaatca tcggctcgta taatgtgtgg aattgtgagc ggataacaat

     1981 ttcacacagg aaacagcgat gaattcgagc tcggtacccg gggatcctct agagtcgacc

     2041 tgcaggcatg caagcttggc actggccgtc gttttacaac gtcgtgactg ggaaaaccct

     2101 ggcgttaccc aacttaatcg ccttgcagca catccccctt tcgccagctg gcgtaatagc

     2161 gaagaggccc gcaccgatcg cccttcccaa cagttgcgca gcctgaatgg cgaatggcgc

     2221 ctgatgcggt attttctcct tacgcatctg tgcggtattt cacaccgcat aaattccctg

     2281 ttttggcgga tgagagaaga ttttcagcct gatacagatt aaatcagaac gcagaagcgg

     2341 tctgataaaa cagaatttgc ctggcggcag tagcgcggtg gtcccacctg accccatgcc

     2401 gaactcagaa gtgaaacgcc gtagcgccga tggtagtgtg gggtctcccc atgcgagagt

     2461 agggaactgc caggcatcaa ataaaacgaa aggctcagtc gaaagactgg gcctttcgtt

     2521 ttatctgttg tttgtcggtg aacgctctcc tgagtaggac aaatccgccg ggagcggatt

     2581 tgaacgttgc gaagcaacgg cccggagggt ggcgggcagg acgcccgcca taaactgcca

     2641 ggcatcaaat taagcagaag gccatcctga cggatggcct ttttgcgttt ctacaaactc

     2701 ttcctgtcgt catatctaca agccatcccc ccacagatac ggtaaactag cctcgttttt

     2761 gcatcaggaa agcagggaat ttatggtgca ctctcagtac aatctgctct gatgccgcat

     2821 agttaagcca gccccgacac ccgccaacac ccgctgacgc gccctgacgg gcttgtctgc

     2881 tcccggcatc cgcttacaga caagctgtga ccgtctccgg gagctgcatg tgtcagaggt

     2941 tttcaccgtc atcaccgaaa cgcgcgagac gaaagggcct cgtgatacgc ctatttttat

     3001 aggttaatgt catgataata atggtttctt agacgtgagg ttctgtaccc gacaccatcg

     3061 aatggtgcaa aacctttcgc ggtatggcat gatagcgccc ggaagagagt caattcaggg

     3121 tggtgaatgt gaaaccagta acgttatacg atgtcgcaga gtatgccggt gtctcttatc

     3181 agaccgtttc ccgcgtggtg aaccaggcca gccacgtttc tgcgaaaacg cgggaaaaag

     3241 tggaagcggc gatggcggag ctgaattaca ttcccaaccg cgtggcacaa caactggcgg

     3301 gcaaacagtc gttgctgatt ggcgttgcca cctccagtct ggccctgcac gcgccgtcgc

     3361 aaattgtcgc ggcgattaaa tctcgcgccg atcaactggg tgccagcgtg gtggtgtcga

     3421 tggtagaacg aagcggcgtc gaagcctgta aagcggcggt gcacaatctt ctcgcgcaac

     3481 gcgtcagtgg gctgatcatt aactatccgc tggatgacca ggatgccatt gctgtggaag

     3541 ctgcctgcac taatgttccg gcgttatttc ttgatgtctc tgaccagaca cccatcaaca

     3601 gtattatttt ctcccatgaa gacggtacgc gactgggcgt ggagcatctg gtcgcattgg

     3661 gtcaccagca aatcgcgctg ttagcgggcc cattaagttc tgtctcggcg cgtctgcgtc

     3721 tggctggctg gcataaatat ctcactcgca atcaaattca gccgatagcg gaacgggaag

     3781 gcgactggag tgccatgtcc ggttttcaac aaaccatgca aatgctgaat gagggcatcg

     3841 ttcccactgc gatgctggtt gccaacgatc agatggcgct gggcgcaatg cgcgccatta

     3901 ccgagtccgg gctgcgcgtt ggtgcggata tctcggtagt gggatacgac gataccgaag

     3961 acagctcatg ttatatcccg ccgttaacca ccatcaaaca ggattttcgc ctgctggggc

     4021 aaaccagcgt ggaccgcttg ctgcaactct ctcagggcca ggcggtgaag ggcaatcagc

     4081 tgttgcccgt ctcactggtg aaaagaaaaa ccaccctggc gcccaatacg caaaccgcct

     4141 ctccccgcgc gttggccgat tcattaatgc agctggcacg acaggtttcc cgactggaaa

     4201 gcgggcagtg agcgcaacgc aattaatgta agttagctca ctcattaggc accccaggct

     4261 ttacacttta tgcttccgac ctgcaagaac ctcacgtcag gtggcacttt tcggggaaat

     4321 gtgcgcggaa cccctatttg tttatttttc taaatacatt caaatatgta tccgctcatg

     4381 agacaataac cctgataaat gcttcaataa tattgaaaaa ggaagagtat gagtattcaa

     4441 catttccgtg tcgcccttat tccctttttt gcggcatttt gccttcctgt ttttgctcac

     4501 ccagaaacgc tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg agtgggttac

     4561 atc

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart