pTYB1

$216.00

  • Model: PVT0820
  • 50 Units in Stock
Ask a question


Add to Cart:

pTYB1

PVT0820     2ug
 

pTYB1 Informaiton

Promoter: T7
Replicon: M13 ori
Plasmid classification: Escherichia coli vector; protein expression plasmid
Plasmid size: 7477bp
Plasmid label: Intein
Prokaryotic resistance: ampicillin Amp
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
5'sequencing primers: T7:TAATACGACTCACTATAGGG
3'sequencing primers: Based on sequence design
Remarks: expression plasmids
 

pTYB1 Description
pTYB1 is an E. coli vector created for fusion protein expression and purification. A target gene can be inserted into the the ORF by use of the MCS upstream of the Sce VMA intein. The NdeI site in the MCS has the initiator sequence ATG that enables translation of the ORF. The chitin-binding domain(CBD) downstream of the intein results in a target protein-intein with C-terminal chitin beads that facilitate protein purification. Release of the protein is induced by the thiol cleavage activity of the intein.
pTYB1-plasmid

pTYB1 Sequence

LOCUS       pTYB1 7477 bp  DNA SYN
DEFINITION  pTYB1
ACCESSION  
KEYWORDS   
SOURCE     
  ORGANISM  other sequences; artificial sequences; vectors.
FEATURES             Location/Qualifiers
     source          1..7477
                     /organism="pTYB1"
                     /mol_type="other DNA"
     promoter        70..98
                     /label="AmpR_promoter"
     gene            140..1000
                     /label="Ampicillin"
                     /gene="Ampicillin"
     CDS             140..1000
                     /label="ORF frame 2"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW*"
     rep_origin      complement(1232..1538)
                     /label="f1_origin"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW*"
     rep_origin      1650..2269
                     /label="pBR322_origin"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW*"
     misc_feature    2607..2629
                     /label="pGEX_3_primer"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW*"
     misc_feature    complement(2623..2814)
                     /label="ROP"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW*"
     CDS             2953..3588
                     /label="ORF frame 1"
                     /translation="MDAAGPEKNHSGSMPAERQQDVAQRVGRHAGDNGLLLAETFGGG
                     TSDEGLSEGVQDSEYRKRQADHRRAPAKAVLAENDPERCRHLSYELHDKEDSHKCGDD
                     SHAPRPPEGADWVEGSQGHRSRSRCLMSELTYINCVALTARFPVGKPVVPAALMNRPT
                     RGERRFAYWAPGWFFFSPVRRATADCPSPPGPERVAASGPRWFAPAGENPV*"
     gene            complement(3010..3309)
                     /label="tet (611 - 312)"
                     /gene="tet (611 - 312)"
                     /translation="MDAAGPEKNHSGSMPAERQQDVAQRVGRHAGDNGLLLAETFGGG
                     TSDEGLSEGVQDSEYRKRQADHRRAPAKAVLAENDPERCRHLSYELHDKEDSHKCGDD
                     SHAPRPPEGADWVEGSQGHRSRSRCLMSELTYINCVALTARFPVGKPVVPAALMNRPT
                     RGERRFAYWAPGWFFFSPVRRATADCPSPPGPERVAASGPRWFAPAGENPV*"
     misc_feature    complement(3371..4462)
                     /label="lacI"
                     /translation="MDAAGPEKNHSGSMPAERQQDVAQRVGRHAGDNGLLLAETFGGG
                     TSDEGLSEGVQDSEYRKRQADHRRAPAKAVLAENDPERCRHLSYELHDKEDSHKCGDD
                     SHAPRPPEGADWVEGSQGHRSRSRCLMSELTYINCVALTARFPVGKPVVPAALMNRPT
                     RGERRFAYWAPGWFFFSPVRRATADCPSPPGPERVAASGPRWFAPAGENPV*"
     CDS             complement(3371..4330)
                     /label="ORF frame 1"
                     /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKS
                     RADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNV
                     PALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGW
                     HKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITE
                     SGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQ
                     LLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ*"
     CDS             complement(4654..5415)
                     /label="ORF frame 2"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     terminator      4687..4730
                     /label="rrnB_T1_terminator"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     terminator      4870..4913
                     /label="rrnB_T1_terminator"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     terminator      5053..5096
                     /label="rrnB_T1_terminator"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     terminator      5236..5279
                     /label="rrnB_T1_terminator"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     terminator      5419..5462
                     /label="rrnB_T1_terminator"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     promoter        5637..5655
                     /label="T7_promoter"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     misc_feature    5655..5682
                     /label="lacO"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     misc_feature    5700..5716
                     /label="T7_transl_en_RBS"
                     /translation="MPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVHRQT
                     TDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQESVH
                     RQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICPTQE
                     SVHRQTTDKTKGPVFRLSLSFYLMPGELIPGSLWRASCPPPSGPLLRNVQIRSRRICP
                     TQESVHRQTTDKTKGPVFRLSLSFYLMPGELGINS*"
     CDS             5725..7329
                     /label="ORF frame 1"
                     /translation="MASSRVDGGREFLEGSSCFAKGTNVLMADGSIECIENIEVGNKV
                     MGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRT
                     PRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPERANELV
                     ESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDHFFDYMQKSKFHLT
                     IEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQ
                     VAKTVNLYSKVVRGNGIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRET
                     FLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVT
                     KHKISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYG
                     ITLSDDSDHQFLLGSQVVVHACGGLTGLNSGLTTNPGVSAWQVNTAYTAGQLVTYNGK
                     TYKCLQPHTSLAGWEPSNVPALWQLQ*"
     terminator      7349..7477
                     /label="T7_terminator"
                     /translation="MASSRVDGGREFLEGSSCFAKGTNVLMADGSIECIENIEVGNKV
                     MGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRT
                     PRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPERANELV
                     ESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDHFFDYMQKSKFHLT
                     IEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQ
                     VAKTVNLYSKVVRGNGIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRET
                     FLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVT
                     KHKISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYG
                     ITLSDDSDHQFLLGSQVVVHACGGLTGLNSGLTTNPGVSAWQVNTAYTAGQLVTYNGK
                     TYKCLQPHTSLAGWEPSNVPALWQLQ*"
     misc_feature    complement(7391..7409)
                     /label="T7_Terminal_primer"
                     /translation="MASSRVDGGREFLEGSSCFAKGTNVLMADGSIECIENIEVGNKV
                     MGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRT
                     PRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPERANELV
                     ESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDHFFDYMQKSKFHLT
                     IEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQ
                     VAKTVNLYSKVVRGNGIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRET
                     FLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVT
                     KHKISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYG
                     ITLSDDSDHQFLLGSQVVVHACGGLTGLNSGLTTNPGVSAWQVNTAYTAGQLVTYNGK
                     TYKCLQPHTSLAGWEPSNVPALWQLQ*"
ORIGIN
    1 AACTACGTCA GGTGGCACTT TTCGGGGAAA TGTGCGCGGA ACCCCTATTT GTTTATTTTT
   61 CTAAATACAT TCAAATATGT ATCCGCTCAT GAGACAATAA CCCTGATAAA TGCTTCAATA
  121 ATATTGAAAA AGGAAGAGTA TGAGTATTCA ACATTTCCGT GTCGCCCTTA TTCCCTTTTT
  181 TGCGGCATTT TGCCTTCCTG TTTTTGCTCA CCCAGAAACG CTGGTGAAAG TAAAAGATGC
  241 TGAAGATCAG TTGGGTGCAC GAGTGGGTTA CATCGAACTG GATCTCAACA GCGGTAAGAT
  301 CCTTGAGAGT TTTCGCCCCG AAGAACGTTC TCCAATGATG AGCACTTTTA AAGTTCTGCT
  361 ATGTGGCGCG GTATTATCCC GTGTTGACGC CGGGCAAGAG CAACTCGGTC GCCGCATACA
  421 CTATTCTCAG AATGACTTGG TTGAGTACTC ACCAGTCACA GAAAAGCATC TTACGGATGG
  481 CATGACAGTA AGAGAATTAT GCAGTGCTGC CATAACCATG AGTGATAACA CTGCGGCCAA
  541 CTTACTTCTG ACAACGATCG GAGGACCGAA GGAGCTAACC GCTTTTTTGC ACAACATGGG
  601 GGATCATGTA ACTCGCCTTG ATCGTTGGGA ACCGGAGCTG AATGAAGCCA TACCAAACGA
  661 CGAGCGTGAC ACCACGATGC CTGTAGCAAT GGCAACAACG TTGCGCAAAC TATTAACTGG
  721 CGAACTACTT ACTCTAGCTT CCCGGCAACA ATTAATAGAC TGGATGGAGG CGGATAAAGT
  781 TGCAGGACCA CTTCTGCGCT CGGCCCTTCC GGCTGGCTGG TTTATTGCTG ATAAATCTGG
  841 AGCCGGTGAG CGTGGGTCTC GCGGTATCAT TGCAGCACTG GGGCCAGATG GTAAGCCCTC
  901 CCGTATCGTA GTTATCTACA CGACGGGGAG TCAGGCAACT ATGGATGAAC GAAATAGACA
  961 GATCGCTGAG ATAGGTGCCT CACTGATTAA GCATTGGTAA CTGTCAGACC AAGTTTACTC
1021 ATATATACTT TAGATTGATT TACCCCGGTT GATAATCAGA AAAGCCCCAA AAACAGGAAG
1081 ATTGTATAAG CAAATATTTA AATTGTAAAC GTTAATATTT TGTTAAAATT CGCGTTAAAT
1141 TTTTGTTAAA TCAGCTCATT TTTTAACCAA TAGGCCGAAA TCGGCAAAAT CCCTTATAAA
1201 TCAAAAGAAT AGCCCGAGAT AGGGTTGAGT GTTGTTCCAG TTTGGAACAA GAGTCCACTA
1261 TTAAAGAACG TGGACTCCAA CGTCAAAGGG CGAAAAACCG TCTATCAGGG CGATGGCCCA
1321 CTACGTGAAC CATCACCCAA ATCAAGTTTT TTGGGGTCGA GGTGCCGTAA AGCACTAAAT
1381 CGGAACCCTA AAGGGAGCCC CCGATTTAGA GCTTGACGGG GAAAGCCGGC GAACGTGGCG
1441 AGAAAGGAAG GGAAGAAAGC GAAAGGAGCG GGCGCTAGGG CGCTGGCAAG TGTAGCGGTC
1501 ACGCTGCGCG TAACCACCAC ACCCGCCGCG CTTAATGCGC CGCTACAGGG CGCGTAAAAG
1561 GATCTAGGTG AAGATCCTTT TTGATAATCT CATGACCAAA ATCCCTTAAC GTGAGTTTTC
1621 GTTCCACTGA GCGTCAGACC CCGTAGAAAA GATCAAAGGA TCTTCTTGAG ATCCTTTTTT
1681 TCTGCGCGTA ATCTGCTGCT TGCAAACAAA AAAACCACCG CTACCAGCGG TGGTTTGTTT
1741 GCCGGATCAA GAGCTACCAA CTCTTTTTCC GAAGGTAACT GGCTTCAGCA GAGCGCAGAT
1801 ACCAAATACT GTCCTTCTAG TGTAGCCGTA GTTAGGCCAC CACTTCAAGA ACTCTGTAGC
1861 ACCGCCTACA TACCTCGCTC TGCTAATCCT GTTACCAGTG GCTGCTGCCA GTGGCGATAA
1921 GTCGTGTCTT ACCGGGTTGG ACTCAAGACG ATAGTTACCG GATAAGGCGC AGCGGTCGGG
1981 CTGAACGGGG GGTTCGTGCA CACAGCCCAG CTTGGAGCGA ACGACCTACA CCGAACTGAG
2041 ATACCTACAG CGTGAGCTAT GAGAAAGCGC CACGCTTCCC GAAGGGAGAA AGGCGGACAG
2101 GTATCCGGTA AGCGGCAGGG TCGGAACAGG AGAGCGCACG AGGGAGCTTC CAGGGGGAAA
2161 CGCCTGGTAT CTTTATAGTC CTGTCGGGTT TCGCCACCTC TGACTTGAGC GTCGATTTTT
2221 GTGATGCTCG TCAGGGGGGC GGAGCCTATG GAAAAACGCC AGCAACGCGG CCTTTTTACG
2281 GTTCCTGGCC TTTTGCTGGC CTTTTGCTCA CATGTTCTTT CCTGCGTTAT CCCCTGATTC
2341 TGTGGATAAC CGTATTACCG CCTTTGAGTG AGCTGATACC GCTCGCCGCA GCCGAACGAC
2401 CGAGCGCAGC GAGTCAGTGA GCGAGGAAGC TATGGTGCAC TCTCAGTACA ATCTGCTCTG
2461 ATGCCGCATA GTTAAGCCAG TATACACTCC GCTATCGCTA CGTGACTGGG TCATGGCTGC
2521 GCCCCGACAC CCGCCAACAC CCGCTGACGC GCCCTGACGG GCTTGTCTGC TCCCGGCATC
2581 CGCTTACAGA CAAGCTGTGA CCGTCTCCGG GAGCTGCATG TGTCAGAGGT TTTCACCGTC
2641 ATCACCGAAA CGCGCGAGGC AGCTGCGGTA AAGCTCATCA GCGTGGTCGT GCAGCGATTC
2701 ACAGATGTCT GCCTGTTCAT CCGCGTCCAG CTCGTTGAGT TTCTCCAGAA GCGTTAATGT
2761 CTGGCTTCTG ATAAAGCGGG CCATGTTAAG GGCGGTTTTT TCCTGTTTGG TCACTGATGC
2821 CTCCGTGTAA GGGGGATTTC TGTTCATGGG GGTAATGATA CCGATGAAAC GAGAGAGGAT
2881 GCTCACGATA CGGGTTACTG ATGATGAACA TGCCCGGTTA CTGGAACGTT GTGAGGGTAA
2941 ACAACTGGCG GTATGGATGC GGCGGGACCA GAGAAAAATC ACTCAGGGTC AATGCCAGCC
3001 GAACGCCAGC AAGACGTAGC CCAGCGCGTC GGCCGCCATG CCGGCGATAA TGGCCTGCTT
3061 CTCGCCGAAA CGTTTGGTGG CGGGACCAGT GACGAAGGCT TGAGCGAGGG CGTGCAAGAT
3121 TCCGAATACC GCAAGCGACA GGCCGATCAT CGTCGCGCTC CAGCGAAAGC GGTCCTCGCC
3181 GAAAATGACC CAGAGCGCTG CCGGCACCTG TCCTACGAGT TGCATGATAA AGAAGACAGT
3241 CATAAGTGCG GCGACGATAG TCATGCCCCG CGCCCACCGG AAGGAGCTGA CTGGGTTGAA
3301 GGCTCTCAAG GGCATCGGTC GAGATCCCGG TGCCTAATGA GTGAGCTAAC TTACATTAAT
3361 TGCGTTGCGC TCACTGCCCG CTTTCCAGTC GGGAAACCTG TCGTGCCAGC TGCATTAATG
3421 AATCGGCCAA CGCGCGGGGA GAGGCGGTTT GCGTATTGGG CGCCAGGGTG GTTTTTCTTT
3481 TCACCAGTGA GACGGGCAAC AGCTGATTGC CCTTCACCGC CTGGCCCTGA GAGAGTTGCA
3541 GCAAGCGGTC CACGCTGGTT TGCCCCAGCA GGCGAAAATC CTGTTTGATG GTGGTTAACG
3601 GCGGGATATA ACATGAGCTG TCTTCGGTAT CGTCGTATCC CACTACCGAG ATATCCGCAC
3661 CAACGCGCAG CCCGGACTCG GTAATGGCGC GCATTGCGCC CAGCGCCATC TGATCGTTGG
3721 CAACCAGCAT CGCAGTGGGA ACGATGCCCT CATTCAGCAT TTGCATGGTT TGTTGAAAAC
3781 CGGACATGGC ACTCCAGTCG CCTTCCCGTT CCGCTATCGG CTGAATTTGA TTGCGAGTGA
3841 GATATTTATG CCAGCCAGCC AGACGCAGAC GCGCCGAGAC AGAACTTAAT GGGCCCGCTA
3901 ACAGCGCGAT TTGCTGGTGA CCCAATGCGA CCAGATGCTC CACGCCCAGT CGCGTACCGT
3961 CTTCATGGGA GAAAATAATA CTGTTGATGG GTGTCTGGTC AGAGACATCA AGAAATAACG
4021 CCGGAACATT AGTGCAGGCA GCTTCCACAG CAATGGCATC CTGGTCATCC AGCGGATAGT
4081 TAATGATCAG CCCACTGACG CGTTGCGCGA GAAGATTGTG CACCGCCGCT TTACAGGCTT
4141 CGACGCCGCT TCGTTCTACC ATCGACACCA CCACGCTGGC ACCCAGTTGA TCGGCGCGAG
4201 ATTTAATCGC CGCGACAATT TGCGACGGCG CGTGCAGGGC CAGACTGGAG GTGGCAACGC
4261 CAATCAGCAA CGACTGTTTG CCCGCCAGTT GTTGTGCCAC GCGGTTGGGA ATGTAATTCA
4321 GCTCCGCCAT CGCCGCTTCC ACTTTTTCCC GCGTTTTCGC AGAAACGTGG CTGGCCTGGT
4381 TCACCACGCG GGAAACGGTC TGATAAGAGA CACCGGCATA CTCTGCGACA TCGTATAACG
4441 TTACTGGTTT CACATTCACC ACCCTGAATT GACTCTCTTC CGGGCGCTAT CATGCCATAC
4501 CGCGAAAGGT TTTGCGCCAT TCGATGGTGT CCGGGATCTC GACGCTCTCC CTTATGCGAC
4561 TCCTGCATTA GGAAGCAGCC CAGTAGTAGG TTGAGGCCGT TGAGCACCGC CGCCGCAAGG
4621 AATGGTGCAT GCCGGCATGC CGCCCTTTCG TCTTCAAGAA TTAATTCCCA ATTCCCCAGG
4681 CATCAAATAA AACGAAAGGC TCAGTCGAAA GACTGGGCCT TTCGTTTTAT CTGTTGTTTG
4741 TCGGTGAACG CTCTCCTGAG TAGGACAAAT CCGCCGGGAG CGGATTTGAA CGTTGCGAAG
4801 CAACGGCCCG GAGGGTGGCG GGCAGGACGC CCGCCATAAA CTGCCAGGAA TTAATTCCCC
4861 AGGCATCAAA TAAAACGAAA GGCTCAGTCG AAAGACTGGG CCTTTCGTTT TATCTGTTGT
4921 TTGTCGGTGA ACGCTCTCCT GAGTAGGACA AATCCGCCGG GAGCGGATTT GAACGTTGCG
4981 AAGCAACGGC CCGGAGGGTG GCGGGCAGGA CGCCCGCCAT AAACTGCCAG GAATTAATTC
5041 CCCAGGCATC AAATAAAACG AAAGGCTCAG TCGAAAGACT GGGCCTTTCG TTTTATCTGT
5101 TGTTTGTCGG TGAACGCTCT CCTGAGTAGG ACAAATCCGC CGGGAGCGGA TTTGAACGTT
5161 GCGAAGCAAC GGCCCGGAGG GTGGCGGGCA GGACGCCCGC CATAAACTGC CAGGAATTAA
5221 TTCCCCAGGC ATCAAATAAA ACGAAAGGCT CAGTCGAAAG ACTGGGCCTT TCGTTTTATC
5281 TGTTGTTTGT CGGTGAACGC TCTCCTGAGT AGGACAAATC CGCCGGGAGC GGATTTGAAC
5341 GTTGCGAAGC AACGGCCCGG AGGGTGGCGG GCAGGACGCC CGCCATAAAC TGCCAGGAAT
5401 TAATTCCCCA GGCATCAAAT AAAACGAAAG GCTCAGTCGA AAGACTGGGC CTTTCGTTTT
5461 ATCTGTTGTT TGTCGGTGAA CGCTCTCCTG AGTAGGACAA ATCCGCCGGG AGCGGATTTG
5521 AACGTTGCGA AGCAACGGCC CGGAGGGTGG CGGGCAGGAC GCCCGCCATA AACTGCCAGG
5581 AATTGGGGAT CGGAATTAAT TCCCGGTTTA AACCGGGGAT CTCGATCCCG CGAAATTAAT
5641 ACGACTCACT ATAGGGGAAT TGTGAGCGGA TAACAATTCC CCTCTAGAAA TAATTTTGTT
5701 TAACTTTAAG AAGGAGATAT ACATATGGCT AGCTCGCGAG TCGACGGCGG CCGCGAATTC
5761 CTCGAGGGCT CTTCCTGCTT TGCCAAGGGT ACCAATGTTT TAATGGCGGA TGGGTCTATT
5821 GAATGTATTG AAAACATTGA GGTTGGTAAT AAGGTCATGG GTAAAGATGG CAGACCTCGT
5881 GAGGTAATTA AATTGCCCAG AGGAAGAGAA ACTATGTACA GCGTCGTGCA GAAAAGTCAG
5941 CACAGAGCCC ACAAAAGTGA CTCAAGTCGT GAAGTGCCAG AATTACTCAA GTTTACGTGT
6001 AATGCGACCC ATGAGTTGGT TGTTAGAACA CCTCGTAGTG TCCGCCGTTT GTCTCGTACC
6061 ATTAAGGGTG TCGAATATTT TGAAGTTATT ACTTTTGAGA TGGGCCAAAA GAAAGCCCCC
6121 GACGGTAGAA TTGTTGAGCT TGTCAAGGAA GTTTCAAAGA GCTACCCAAT ATCTGAGGGG
6181 CCTGAGAGAG CCAACGAATT AGTAGAATCC TATAGAAAGG CTTCAAATAA AGCTTATTTT
6241 GAGTGGACTA TTGAGGCCAG AGATCTTTCT CTGTTGGGTT CCCATGTTCG TAAAGCTACC
6301 TACCAGACTT ACGCTCCAAT TCTTTATGAG AATGACCACT TTTTCGACTA CATGCAAAAA
6361 AGTAAGTTTC ATCTCACCAT TGAAGGTCCA AAAGTACTTG CTTATTTACT TGGTTTATGG
6421 ATTGGTGATG GATTGTCTGA CAGGGCAACT TTTTCGGTTG ATTCCAGAGA TACTTCTTTG
6481 ATGGAACGTG TTACTGAATA TGCTGAAAAG TTGAATTTGT GCGCCGAGTA TAAGGACAGA
6541 AAAGAACCAC AAGTTGCCAA AACTGTTAAT TTGTACTCTA AAGTTGTCAG AGGTAATGGT
6601 ATTCGCAATA ATCTTAATAC TGAGAATCCA TTATGGGACG CTATTGTTGG CTTAGGATTC
6661 TTGAAGGACG GTGTCAAAAA TATTCCTTCT TTCTTGTCTA CGGACAATAT CGGTACTCGT
6721 GAAACATTTC TTGCTGGTCT AATTGATTCT GATGGCTATG TTACTGATGA GCATGGTATT
6781 AAAGCAACAA TAAAGACAAT TCATACTTCT GTCAGAGATG GTTTGGTTTC CCTTGCTCGT
6841 TCTTTAGGCT TAGTAGTCTC GGTTAACGCA GAACCTGCTA AGGTTGACAT GAATGTCACC
6901 AAACATAAAA TTAGTTATGC TATTTATATG TCTGGTGGAG ATGTTTTGCT TAACGTTCTT
6961 TCGAAGTGTG CCGGCTCTAA AAAATTCAGG CCTGCTCCCG CCGCTGCTTT TGCACGTGAG
7021 TGCCGCGGAT TTTATTTCGA GTTACAAGAA TTGAAGGAAG ACGATTATTA TGGGATTACT
7081 TTATCTGATG ATTCTGATCA TCAGTTTTTG CTTGGATCCC AGGTTGTCGT CCATGCATGC
7141 GGTGGCCTGA CCGGTCTGAA CTCAGGCCTC ACGACAAATC CTGGTGTATC CGCTTGGCAG
7201 GTCAACACAG CTTATACTGC GGGACAATTG GTCACATATA ACGGCAAGAC GTATAAATGT
7261 TTGCAGCCCC ACACCTCCTT GGCAGGATGG GAACCATCCA ACGTTCCTGC CTTGTGGCAG
7321 CTTCAATGAC TGCAGGAAGG GGATCCGGCT GCTAACAAAG CCCGAAAGGA AGCTGAGTTG
7381 GCTGCTGCCA CCGCTGAGCA ATAACTAGCA TAACCCCTTG GGGCCTCTAA ACGGGTCTTG
7441 AGGGGTTTTT TGCTGAAAGG AGGAACTATA TCCGGAT
//
 

Caution:
Product is for research use only!
 

Search name

pTYB1,Plasmid pTYB1,pTYB1 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart