pUC57- Kan

$182.00

  • Model: PVT10562
  • 50 Units in Stock
Ask a question


Add to Cart:

pUC57-Kan


Catalog No. PVT10562
Packing 2ug

 

pUC57-Kan Description

pUC57-Kan is a E.coli Cloning plasmid.

 

pUC57-Kan Information

Promoter: Lac/lac

Replicon: ColE1 ori

Plasmid classification: Escherichia coli vector; cloning plasmid

Plasmid size: 2579bp

Plasmid tagging: LacZ

Prokaryotic resistance: kanamycin Kan

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic, LB

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Remarks: blue spot screening

 

 

pUC57-Kan Multiple cloning site

pUC57-Kan-vector

 

pUC57-Kan Sequence

LOCUS       Exported File           2579 bp ds-DNA    circular SYN 02-2-2015
DEFINITION  .
ACCESSION   .
VERSION     .
KEYWORDS    pUC57-Kan
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2579)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported 2015-2-2
FEATURES             Location/Qualifiers
     source          1..2579
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     379..395
                     /note="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(489..505)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    513..529
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(537..567)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    582..603
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(891..1479)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(1657..2466)
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /note="KanR"
                     /note="confers resistance to kanamycin in bacteria or G418
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
ORIGIN
        1 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
       61 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
      121 ttggcgggtg tcggggctgg cttaactatg cggcatcaga gcagattgta ctgagagtgc
      181 accatatgcg gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgcc
      241 attcgccatt caggctgcgc aactgttggg aagggcgatc ggtgcgggcc tcttcgctat
      301 tacgccagct ggcgaaaggg ggatgtgctg caaggcgatt aagttgggta acgccagggt
      361 tttcccagtc acgacgttgt aaaacgacgg ccagtgaatt cgagctcggt acctcgcgaa
      421 tgcatctaga tatcggatcc cgggcccgtc gactgcagag gcctgcatgc aagcttggcg
      481 taatcatggt catagctgtt tcctgtgtga aattgttatc cgctcacaat tccacacaac
      541 atacgagccg gaagcataaa gtgtaaagcc tggggtgcct aatgagtgag ctaactcaca
      601 ttaattgcgt tgcgctcact gcccgctttc cagtcgggaa acctgtcgtg ccagctgcat
      661 taatgaatcg gccaacgcgc ggggagaggc ggtttgcgta ttgggcgctc ttccgcttcc
      721 tcgctcactg actcgctgcg ctcggtcgtt cggctgcggc gagcggtatc agctcactca
      781 aaggcggtaa tacggttatc cacagaatca ggggataacg caggaaagaa catgtgagca
      841 aaaggccagc aaaaggccag gaaccgtaaa aaggccgcgt tgctggcgtt tttccatagg
      901 ctccgccccc ctgacgagca tcacaaaaat cgacgctcaa gtcagaggtg gcgaaacccg
      961 acaggactat aaagatacca ggcgtttccc cctggaagct ccctcgtgcg ctctcctgtt
     1021 ccgaccctgc cgcttaccgg atacctgtcc gcctttctcc cttcgggaag cgtggcgctt
     1081 tctcatagct cacgctgtag gtatctcagt tcggtgtagg tcgttcgctc caagctgggc
     1141 tgtgtgcacg aaccccccgt tcagcccgac cgctgcgcct tatccggtaa ctatcgtctt
     1201 gagtccaacc cggtaagaca cgacttatcg ccactggcag cagccactgg taacaggatt
     1261 agcagagcga ggtatgtagg cggtgctaca gagttcttga agtggtggcc taactacggc
     1321 tacactagaa gaacagtatt tggtatctgc gctctgctga agccagttac cttcggaaaa
     1381 agagttggta gctcttgatc cggcaaacaa accaccgctg gtagcggtgg tttttttgtt
     1441 tgcaagcagc agattacgcg cagaaaaaaa ggatctcaag aagatccttt gatcttttct
     1501 acggggtctg acgctcagtg gaacgaaaac tcacgttaag ggattttggt catgagatta
     1561 tcaaaaagga tcttcaccta gatcctttta aattaaaaat gaagttttaa atcaagccca
     1621 atctgaataa tgttacaacc aattaaccaa ttctgattag aaaaactcat cgagcatcaa
     1681 atgaaactgc aatttattca tatcaggatt atcaatacca tatttttgaa aaagccgttt
     1741 ctgtaatgaa ggagaaaact caccgaggca gttccatagg atggcaagat cctggtatcg
     1801 gtctgcgatt ccgactcgtc caacatcaat acaacctatt aatttcccct cgtcaaaaat
     1861 aaggttatca agtgagaaat caccatgagt gacgactgaa tccggtgaga atggcaaaag
     1921 tttatgcatt tctttccaga cttgttcaac aggccagcca ttacgctcgt catcaaaatc
     1981 actcgcatca accaaaccgt tattcattcg tgattgcgcc tgagcgagac gaaatacgcg
     2041 atcgctgtta aaaggacaat tacaaacagg aatcgaatgc aaccggcgca ggaacactgc
     2101 cagcgcatca acaatatttt cacctgaatc aggatattct tctaatacct ggaatgctgt
     2161 ttttccgggg atcgcagtgg tgagtaacca tgcatcatca ggagtacgga taaaatgctt
     2221 gatggtcgga agaggcataa attccgtcag ccagtttagt ctgaccatct catctgtaac
     2281 atcattggca acgctacctt tgccatgttt cagaaacaac tctggcgcat cgggcttccc
     2341 atacaagcga tagattgtcg cacctgattg cccgacatta tcgcgagccc atttataccc
     2401 atataaatca gcatccatgt tggaatttaa tcgcggcctc gacgtttccc gttgaatatg
     2461 gctcataaca ccccttgtat tactgtttat gtaagcagac agttttattg ttcatgatga
     2521 tatattttta tcttgtgcaa tgtaacatca gagattttga gacacgggcc agagctgca
//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart