pUC57- sgRNA

$215.00

  • Model: PVT10920
  • 50 Units in Stock
Ask a question


Add to Cart:

pUC57-sgRNA


PVT10920     2ug

 

pUC57-sgRNA Description

The pUC57-sgRNA plasmid is a vector for sgRNA transcription in vitro. The gRNA fragment can be digested by BsaI and transcribed by T7 promoter.

Promoter: T7 promoter

Replicon: pUC ori

Plasmid size: 2792bp

Prokaryotic resistance: kanamycin Kan

Clone strain: Escherichia coli DH5 alpha

Culture conditions: 37 C, aerobic, LB

 

pUC57-sgRNA  Reference

Efficient genome modification by CRISPR-Cas9 nickase with minimal off-target effects.

 

pUC57-sgRNA Sequence

 

LOCUS       Exported                2792 bp ds-DNA     circular SYN 26-OCT-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2792)
  AUTHORS   .
  TITLE     Direct Submission
            
FEATURES             Location/Qualifiers
     source          1..2792
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        442..460
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_RNA        482..557
                     /label=gRNA scaffold
                     /note="guide RNA scaffold for the Streptococcus pyogenes 
                     CRISPR/Cas9 system"
     rep_origin      complement(1018..1606)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1777..2592)
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     promoter        complement(2593..2697)
                     /gene="bla"
                     /label=AmpR promoter
ORIGIN
        1 tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca
       61 cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg
      121 ttggcgggtg tcggggctgg cttaactatg cggcatcaga gcagattgta ctgagagtgc
      181 accatatgcg gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgcc
      241 attcgccatt caggctgcgc aactgttggg aagggcgatc ggtgcgggcc tcttcgctat
      301 tacgccagct ggcgaaaggg ggatgtgctg caaggcgatt aagttgggta acgccagggt
      361 tttcccagtc acgacgttgt aaaacgacgg ccagtgaatt cgagctcggt acctcgcgaa
      421 tgcatctaga tatcggatcc ctaatacgac tcactatagg tgagaccgag agagggtctc
      481 agttttagag ctagaaatag caagttaaaa taaggctagt ccgttatcaa cttgaaaaag
      541 tggcaccgag tcggtgcttt ttttaaaggg cccgtcgact gcagaggcct gcatgcaagc
      601 ttggcgtaat catggtcata gctgtttcct gtgtgaaatt gttatccgct cacaattcca
      661 cacaacatac gagccggaag cataaagtgt aaagcctggg gtgcctaatg agtgagctaa
      721 ctcacattaa ttgcgttgcg ctcactgccc gctttccagt cgggaaacct gtcgtgccag
      781 ctgcattaat gaatcggcca acgcgcgggg agaggcggtt tgcgtattgg gcgcggccgc
      841 cgcttcctcg ctcactgact cgctgcgctc ggtcgttcgg ctgcggcgag cggtatcagc
      901 tcactcaaag gcggtaatac ggttatccac agaatcaggg gataacgcag gaaagaacat
      961 gtgagcaaaa ggccagcaaa aggccaggaa ccgtaaaaag gccgcgttgc tggcgttttt
     1021 ccataggctc cgcccccctg acgagcatca caaaaatcga cgctcaagtc agaggtggcg
     1081 aaacccgaca ggactataaa gataccaggc gtttccccct ggaagctccc tcgtgcgctc
     1141 tcctgttccg accctgccgc ttaccggata cctgtccgcc tttctccctt cgggaagcgt
     1201 ggcgctttct catagctcac gctgtaggta tctcagttcg gtgtaggtcg ttcgctccaa
     1261 gctgggctgt gtgcacgaac cccccgttca gcccgaccgc tgcgccttat ccggtaacta
     1321 tcgtcttgag tccaacccgg taagacacga cttatcgcca ctggcagcag ccactggtaa
     1381 caggattagc agagcgaggt atgtaggcgg tgctacagag ttcttgaagt ggtggcctaa
     1441 ctacggctac actagaagaa cagtatttgg tatctgcgct ctgctgaagc cagttacctt
     1501 cggaaaaaga gttggtagct cttgatccgg caaacaaacc accgctggta gcggtggttt
     1561 ttttgtttgc aagcagcaga ttacgcgcag aaaaaaagga tctcaagaag atcctttgat
     1621 cttttctacg gggtctgacg ctcagtggaa cgaaaactca cgttaaggga ttttggtcat
     1681 gagattatca aaaaggatct tcacctagat ccttttaaat taaaaatgaa gttttaaatc
     1741 aatctaaagt atatatgagt aaacttggtc tgacagttag aaaaactcat cgagcatcaa
     1801 atgaaactgc aatttattca tatcaggatt atcaatacca tatttttgaa aaagccgttt
     1861 ctgtaatgaa ggagaaaact caccgaggca gttccatagg atggcaagat cctggtatcg
     1921 gtctgcgatt ccgactcgtc caacatcaat acaacctatt aatttcccct cgtcaaaaat
     1981 aaggttatca agtgagaaat caccatgagt gacgactgaa tccggtgaga atggcaaaag
     2041 tttatgcatt tctttccaga cttgttcaac aggccagcca ttacgctcgt catcaaaatc
     2101 actcgcatca accaaaccgt tattcattcg tgattgcgcc tgagcgagac gaaatacgcg
     2161 atcgctgtta aaaggacaat tacaaacagg aatcgaatgc aaccggcgca ggaacactgc
     2221 cagcgcatca acaatatttt cacctgaatc aggatattct tctaatacct ggaatgctgt
     2281 tttcccaggg atcgcagtgg tgagtaacca tgcatcatca ggagtacgga taaaatgctt
     2341 gatggtcgga agaggcataa attccgtcag ccagtttagt ctgaccatct catctgtaac
     2401 atcattggca acgctacctt tgccatgttt cagaaacaac tctggcgcat cgggcttccc
     2461 atacaatcga tagattgtcg cacctgattg cccgacatta tcgcgagccc atttataccc
     2521 atataaatca gcatccatgt tggaatttaa tcgcggccta gagcaagacg tttcccgttg
     2581 aatatggctc atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct
     2641 catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac
     2701 atttccccga aaagtgccac ctgacgtcta agaaaccatt attatcatga cattaaccta
     2761 taaaaatagg cgtatcacga ggccctttcg tc
//
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart