pUMVC Plasmid

$136.00

  • Model: PVT2341
  • 50 Units in Stock
Ask a question


Add to Cart:

pUMVC

Search name

pUMVC,Plasmid pUMVC,pUMVC vector

 

pUMVC Information

Promoter: CMV

Replicon: pUC ori

Terminator: beta -globin poly (A) signal

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 9287bp

Prokaryotic resistance: Kan

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pUMVC Description

PUMVC is a low copy plasmid, cultured at 37. It is a slow virus clone plasmid. The plasmid was transformed into Stbl3.

pUMVC-plasmid

 

pUMVC Sequence

LOCUS       Exported                9287 bp ds-DNA     circular SYN 30-AUG-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 5
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9287)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4
             
FEATURES             Location/Qualifiers
     source          1..9287
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      complement(117..705)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1246..2061)
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /note="KanR"
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     enhancer        2686..3065
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        3066..3269
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     intron          3405..3674
                     /note="CMV intron"
                     /note="modified intron A from human cytomegalovirus"
     CDS             3728..4144
                     /note="gag (truncated)"
                     /note="truncated Moloney murine leukemia virus (MMLV) gag 
                     gene lacking the start codon"
     misc_feature    8504..8878
                     /note="pol region"
                     /note="Moloney murine leukemia virus (MMLV) pol region 
                     containing the splice acceptor site"
     polyA_site      9085..9140
                     /note="beta-globin poly(A) signal"
                     /note="rabbit beta-globin polyadenylation signal"
ORIGIN
        1 cactcaaagg cggtaatacg gttatccaca gaatcagggg ataacgcagg aaagaacatg
       61 tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc
      121 cataggctcc gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga
      181 aacccgacag gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct
      241 cctgttccga ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg
      301 gcgctttctc atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag
      361 ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat
      421 cgtcttgagt ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac
      481 aggattagca gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac
      541 tacggctaca ctagaagaac agtatttggt atctgcgctc tgctgaagcc agttaccttc
      601 ggaaaaagag ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt
      661 tttgtttgca agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc
      721 ttttctacgg ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg
      781 agattatcaa aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca
      841 atctaaagta tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca
      901 cctatctcag cgatctgtct atttcgttca tccatagttg cctgactcgg gggggggggc
      961 gctgaggtct gcctcgtgaa gaaggtgttg ctgactcata ccaggcctga atcgccccat
     1021 catccagcca gaaagtgagg gagccacggt tgatgagagc tttgttgtag gtggaccagt
     1081 tggtgatttt gaacttttgc tttgccacgg aacggtctgc gttgtcggga agatgcgtga
     1141 tctgatcctt caactcagca aaagttcgat ttattcaaca aagccgccgt cccgtcaagt
     1201 cagcgtaatg ctctgccagt gttacaacca attaaccaat tctgattaga aaaactcatc
     1261 gagcatcaaa tgaaactgca atttattcat atcaggatta tcaataccat atttttgaaa
     1321 aagccgtttc tgtaatgaag gagaaaactc accgaggcag ttccatagga tggcaagatc
     1381 ctggtatcgg tctgcgattc cgactcgtcc aacatcaata caacctatta atttcccctc
     1441 gtcaaaaata aggttatcaa gtgagaaatc accatgagtg acgactgaat ccggtgagaa
     1501 tggcaaaagc ttatgcattt ctttccagac ttgttcaaca ggccagccat tacgctcgtc
     1561 atcaaaatca ctcgcatcaa ccaaaccgtt attcattcgt gattgcgcct gagcgagacg
     1621 aaatacgcga tcgctgttaa aaggacaatt acaaacagga atcgaatgca accggcgcag
     1681 gaacactgcc agcgcatcaa caatattttc acctgaatca ggatattctt ctaatacctg
     1741 gaatgctgtt ttcccgggga tcgcagtggt gagtaaccat gcatcatcag gagtacggat
     1801 aaaatgcttg atggtcggaa gaggcataaa ttccgtcagc cagtttagtc tgaccatctc
     1861 atctgtaaca tcattggcaa cgctaccttt gccatgtttc agaaacaact ctggcgcatc
     1921 gggcttccca tacaatcgat agattgtcgc acctgattgc ccgacattat cgcgagccca
     1981 tttataccca tataaatcag catccatgtt ggaatttaat cgcggcctcg agcaagacgt
     2041 ttcccgttga atatggctca taacacccct tgtattactg tttatgtaag cagacagttt
     2101 tattgttcat gatgatatat ttttatcttg tgcaatgtaa catcagagat tttgagacac
     2161 aacgtggctt tccccccccc ccattattga agcatttatc agggttattg tctcatgagc
     2221 ggatacatat ttgaatgtat ttagaaaaat aaacaaatag gggttccgcg cacatttccc
     2281 cgaaaagtgc cacctgacgt ctaagaaacc attattatca tgacattaac ctataaaaat
     2341 aggcgtatca cgaggccctt tcgtctcgcg cgtttcggtg atgacggtga aaacctctga
     2401 cacatgcagc tcccggagac ggtcacagct tgtctgtaag cggatgccgg gagcagacaa
     2461 gcccgtcagg gcgcgtcagc gggtgttggc gggtgtcggg gctggcttaa ctatgcggca
     2521 tcagagcaga ttgtactgag agtgcaccat atgcggtgtg aaataccgca cagatgcgta
     2581 aggagaaaat accgcatcag attggctatt ggccattgca tacgttgtat ccatatcata
     2641 atatgtacat ttatattggc tcatgtccaa cattaccgcc atgttgacat tgattattga
     2701 ctagttatta atagtaatca attacggggt cattagttca tagcccatat atggagttcc
     2761 gcgttacata acttacggta aatggcccgc ctggctgacc gcccaacgac ccccgcccat
     2821 tgacgtcaat aatgacgtat gttcccatag taacgccaat agggactttc cattgacgtc
     2881 aatgggtgga gtatttacgg taaactgccc acttggcagt acatcaagtg tatcatatgc
     2941 caagtacgcc ccctattgac gtcaatgacg gtaaatggcc cgcctggcat tatgcccagt
     3001 acatgacctt atgggacttt cctacttggc agtacatcta cgtattagtc atcgctatta
     3061 ccatggtgat gcggttttgg cagtacatca atgggcgtgg atagcggttt gactcacggg
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart