pWB980

$396.00

  • Model: PVT5015
  • 49 Units in Stock
Ask a question


Add to Cart:

pWB980

PVT5015    2ug

 

pWB980 Information

Bacterial Resistance:Kanamycin

Promoter: P43

Plasmid classification: the wide host series, Bacillus subtilis carrier

Plasmid size: 3787bp

Prokaryotic resistance: kanamycin Kan

Bacillus subtilis: Bacillus subtilis

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Bacillus subtilis

5'sequencing primers: primers designed according to sequence

 

pWB980 Description

pWB705 andpWB980 . pUB110 is the parental plasmid for pUB18 and its derivatives.pWB705 is a pUB18-based secretion vector carrying both the constitutive expressed P43 promoter and the engineered levansucrase signal sequence. pWB980 is a pUB19-based secretion vector. The transcription direction of the P43 promoter is the same as that for the majority of the pUB110-encoded genes. rep, kan, ble, mob and sacB SP represent thesequence coding for replicase, kanamycin resistance marker,bleomycin resistance marker, mobilization protein and the levansucrase signal sequence, respectively. The arrows show the transcription directions for these genes.

 

pWB980 Reference

Article: Cloning and Expression of Staphylococcus Simulans Lysostaphin Enzyme Gene in Bacillus Subtilis WB600

Far BE, Ragheb M, Rahbar R, Mafakher L, Nojookambari NY, Achinas S, Yazdansetad S
Preprint from Research Square, 16 Dec 2020
DOI: 10.21203/rs.3.rs-122682/v1 
PPR: PPR254002 

 

pWB980 Sequence

LOCUS       Exported                3787 bp ds-DNA     circular SYN 29-AUG-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3787)
  TITLE     Direct Submission
  JOURNAL   Exported Aug 29, 2017  
FEATURES             Location/Qualifiers
     source          1..3787
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             309..1313
                     /codon_start=1
                     /gene="repB"
                     /product="RepB replication protein"
                     /label=repB
                     /note="from Enterococcus faecalis plasmid pAM-alpha-1"
                     /db_xref="GI:22652809"
                     /protein_id="AAN03827.1"
                     /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY
                     FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI
                     QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV
                     GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN
                     VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS
                     YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"
ORIGIN
        1 agaacctaaa aagaacgaat ttgaactaac tcataaccga gaggtaaaaa aagaacgaag
       61 tcgagatcag ggaatgagtt tataaaataa aaaaagcacc tgaaaaggtg tctttttttg
      121 atggttttga acttgttctt tcttatcttg atacatatag aaataacgtc atttttattt
      181 tagttgctga aaggtgcgtt gaagtgttgg tatgtatgtg ttttaaagta ttgaaaaccc
      241 ttaaaattgg ttgcacagaa aaaccccatc tgttaaagtt ataagtgact aaacaaataa
      301 ctaaatagat gggggtttct tttaatatta tgtgtcctaa tagtagcatt tattcagatg
      361 aaaaatcaag ggttttagtg gacaagacaa aaagtggaaa agtgagacca tggagagaaa
      421 agaaaatcgc taatgttgat tactttgaac ttctgcatat tcttgaattt aaaaaggctg
      481 aaagagtaaa agattgtgct gaaatattag agtataaaca aaatcgtgaa acaggcgaaa
      541 gaaagttgta tcgagtgtgg ttttgtaaat ccaggctttg tccaatgtgc aactggagga
      601 gagcaatgaa acatggcatt cagtcacaaa aggttgttgc tgaagttatt aaacaaaagc
      661 caacagttcg ttggttgttt ctcacattaa cagttaaaaa tgtttatgat ggcgaagaat
      721 taaataagag tttgtcagat atggctcaag gatttcgccg aatgatgcaa tataaaaaaa
      781 ttaataaaaa tcttgttggt tttatgcgtg caacggaagt gacaataaat aataaagata
      841 attcttataa tcagcacatg catgtattgg tatgtgtgga accaacttat tttaagaata
      901 cagaaaacta cgtgaatcaa aaacaatgga ttcaattttg gaaaaaggca atgaaattag
      961 actatgatcc aaatgtaaaa gttcaaatga ttcgaccgaa aaataaatat aaatcggata
     1021 tacaatcggc aattgacgaa actgcaaaat atcctgtaaa ggatacggat tttatgaccg
     1081 atgatgaaga aaagaatttg aaacgtttgt ctgatttgga ggaaggttta caccgtaaaa
     1141 ggttaatctc ctatggtggt ttgttaaaag aaatacataa aaaattaaac cttgatgaca
     1201 cagaagaagg cgatttgatt catacagatg atgacgaaaa agccgatgaa gatggatttt
     1261 ctattattgc aatgtggaat tgggaacgga aaaattattt tattaaagag tagttcaaca
     1321 aacgggccag tttgttgaag attagatgct ataattgtta ttaaaaggat tgaaggatgc
     1381 ttaggaagac gagttattaa tagctgaata agaacggtgc tctccaaata ttcttattta
     1441 gaaaagcaaa tctaaaatta tctgaaaagg gaatgagaat agtgaatgga ccaataataa
     1501 tgactagaga agaaagaatg aagattgttc atgaaattaa ggaacgaata ttggataaat
     1561 atggggatga tgttaaggct attggtgttt atggctctct tggtcgtcag actgatgggc
     1621 cctattcgga tattgagatg atgtgtgtca tgtcaacaga ggaagcagag ttcagccatg
     1681 aatggacaac cggtgagtgg aaggtggaag tgaattttga tagcgaagag attctactag
     1741 attatgcatc tcaggtggaa tcagattggc cgcttacaca tggtcaattt ttctctattt
     1801 tgccgattta tgattcaggt ggatacttag agaaagtgta tcaaactgct aaatcggtag
     1861 aagcccaaac gttccacgat gcgatttgtg cccttatcgt agaagagctg tttgaatatg
     1921 caggcaaatg gcgtaatatt cgtgtgcaag gaccgacaac atttctacca tccttgactg
     1981 tacaggtagc aatggcaggt gccatgttga ttggtctgca tcatcgcatc tgttatacga
     2041 cgagcgcttc ggtcttaact gaagcagtta agcaatcaga tcttccttca ggttatgacc
     2101 atctgtgcca gttcgtaatg tctggtcaac tttccgactc tgagaaactt ctggaatcgc
     2161 tagagaattt ctggaatggg attcaggagt ggacagaacg acacggatat atagtggatg
     2221 tgtcaaaacg cataccattt tgaacgatga cctctaataa ttgttaatca tgttggttac
     2281 gtatttatta acttctccta gtattagtaa ttatcatggc tgtcatggcg cattaacgga
     2341 ataaagggtg tgcttaaatc gggccatttt gcgtaataag aaaaaggatt aattatgagc
     2401 gaattgaatt aataataagg taatagattt acattagaaa atgaaagggg attttatgcg
     2461 tgagaatgtt acagtctatc ccggcattgc cagtcgggga tattaaaaag agtataggtt
     2521 tttattgcga taaactaggt ttcactttgg ttcaccatga agatggattc gcagttctaa
     2581 tgtgtaatga ggttcggatt catctatggg aggcaagtga tgaaggctgg cgctctcgta
     2641 gtaatgattc accggtttgt acaggtgcgg agtcgtttat tgctggtact gctagttgcc
     2701 gcattgaagt agagggaatt gatgaattat atcaacatat taagcctttg ggcattttgc
     2761 accccaatac atcattaaaa gatcagtggt gggatgaacg agactttgca gtaattgatc
     2821 ccgacaacaa tttgattagc ttttttcaac aaataaaaag ctaaaatcta ttattaatct
     2881 gttcagcaat cgggcgcgat tgctgaataa aagatacgag agacctctct tgtatctttt
     2941 ttattttgag tggttttgtc cgttacacta gaaaaccgaa agacaataaa aattttattc
     3001 ttgctgagtc tggctttcgg taagctagac aaaacggaca aaataaaaat tggcaagggt
     3061 ttaaaggtgg agattttttg agtgatcttc tcaaaaaata ctacctgtcc cttgctgatt
     3121 tttaaacgag cacgagagca aaacccccct ttgctgaggt ggcagagggc aggttttttt
     3181 gtttcttttt tctcgtaaaa aaaagaaagg tcttaaaggt tttatggttt tggtcggcac
     3241 tgaattcgag ctcagcatta ttgagtggat gattatattc cttttgatag gtggtatgtt
     3301 ttcgcttgaa cttttaaata cagccattga acatacggtt gatttaataa ctgacaaaca
     3361 tcaccctctt gctaaagcgg ccaaggacgc tgccgccggg gctgtttgcg tttttgccgt
     3421 gatttcgtgt atcattggtt tacttatttt tttgccaaag ctgtaatggc tgaaaattct
     3481 tacatttatt ttacattttt agaaatgggc gtgaaaaaaa gcgcgcgatt atgtaaaata
     3541 taaagtgata gcggtaccag gagggctgga agaagcagac cgctaacaca gtacataaaa
     3601 aaggagacat gaacgatgaa catcaaaaag tttgcaaaac aagcaacagt attaaccttt
     3661 actaccgcac tgctggcagg aggcgcaact caagcttttg cctcgagctc ggtacccggg
     3721 gatcctctag agtcgacctg caggcatgca agctagcttc agcacaattc caagaaagac
     3781 acgattt
//
 
Caution:
Product is for research use only!

Current Reviews: 1

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart