PX458

$182.00

  • Model: PVT6304
  • 49 Units in Stock
Ask a question


Add to Cart:

PX458

PVT6304     2ug

 

PX458 Information

Carrier: PX458; pSpCas9 (BB) -2A-GFP
Plasmid type: CRISPR/Cas9 vector; gene knockout carrier
High copy / low copy: low copy
Cloning method: AgeI, EcoRI
Promoter: Cbh
Carrier size: 9289bp
5'sequencing primers and sequences: TTTATGGCGAGGCGGCGG
3'sequencing primers and sequences: --
Carrier label: 3XFLAG (N end), GFP (C end)
Vector resistance: Ampicillin (Amp)
Screening markers: -
Cloned strain: Stbl3
Host cell (line): mammalian cell line
Note: -
Stability: stable expression
Composition / inducible type: composition
Virus / non virus: non virus
Use:CRISPR-CAS13-sgRNA plasmid

 

PX458 Description

PX458 is a Mammalian gene editing plasmid with Ampicilin resistance, and its size is 9289bp.

 

PX458 Sequence

LOCUS       Exported                9289 bp ds-DNA     circular SYN 21-SEP-2015

DEFINITION  synthetic circular DNA

KEYWORDS    PX458

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9289)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..9289

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1..241

                     /note="U6 promoter"

                     /note="RNA polymerase III promoter for human U6 snRNA"

     misc_RNA        268..343

                     /note="gRNA scaffold"

                     /note="guide RNA scaffold for the CRISPR/Cas9 system"

     promoter        727..1004

                     /note="chicken beta-actin promoter"

     CDS             1254..1319

                     /codon_start=1

                     /product="three tandem FLAG(R) epitope tags, followed by 

 

an

                     enterokinase cleavage site"

                     /note="3xFLAG"

                     /translation="DYKDHDGDYKDHDIDYKDDDDK"

     CDS             1326..1346

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /note="SV40 NLS"

                     /translation="PKKKRKV"

     CDS             1371..5471

                     /codon_start=1

                     /product="Cas9 (Csn1) endonuclease from the Streptococcus 

                     pyogenes Type II CRISPR/Cas system"

                     /note="Cas9"

                     /note="generates RNA-guided double strand breaks in DNA"

                     

 

/translation="DKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKN

                     

 

LIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESF

                     

 

LVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKF

                     

 

RGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLE

                     

 

NLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQI

                     

 

GDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQ

                     

 

QLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR

                     

 

KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGN

                     

 

SRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF

                     

 

TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDS

                     

 

VEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERL

                     

 

KTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQ

                     

 

LIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH

                     

 

KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYL

                     

 

YYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPS

                     

 

EEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV

                     

 

AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLN

                     

 

AVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTE

                     

 

ITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKE

                     

 

SILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGIT

                     

 

IMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNEL

                     

 

ALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA

                     

 

NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLD

                     ATLIHQSITGLYETRIDLSQLGGD"

     CDS             5472..5519

                     /codon_start=1

                     /product="bipartite nuclear localization signal from 

                     nucleoplasmin"

                     /note="nucleoplasmin NLS"

                     /translation="KRPAATKKAGQAKKKK"

     CDS             5535..5588

                     /codon_start=1

                     /product="2A peptide from Thosea asigna virus capsid 

                     protein"

                     /note="T2A"

                     /note="Eukaryotic ribosomes fail to insert a peptide bond 

                     between the Gly and Pro residues, yielding separate 

                     polypeptides."

                     /translation="EGRGSLLTCGDVEENPGP"

     CDS             5589..6302

                     /codon_start=1

                     /product="enhanced GFP"

                     /note="EGFP"

                     /note="mammalian codon-optimized"

                     

 

/translation="VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK

                     

 

FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG

                     

 

NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV

                     

 

NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE

                     FVTAAGITLGMDELYK"

     polyA_signal    6336..6543

                     /note="bGH poly(A) signal"

                     /note="bovine growth hormone polyadenylation signal"

     repeat_region   6552..6692

                     /note="AAV2 ITR"

                     /note="inverted terminal repeat of adeno-associated virus 

                     serotype 2"

     rep_origin      6767..7222

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        7504..7608

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             7609..8469

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, 

 

and

                     related antibiotics"

                     

 

/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     

 

ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     

 

PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     

 

EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     

 

LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      8640..9228

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gagggcctat ttcccatgat tccttcatat ttgcatatac gatacaaggc tgttagagag

       61 ataattggaa ttaatttgac tgtaaacaca aagatattag tacaaaatac gtgacgtaga

      121 aagtaataat ttcttgggta gtttgcagtt ttaaaattat gttttaaaat ggactatcat

      181 atgcttaccg taacttgaaa gtatttcgat ttcttggctt tatatatctt gtggaaagga

      241 cgaaacaccg ggtcttcgag aagacctgtt ttagagctag aaatagcaag ttaaaataag

      301 gctagtccgt tatcaacttg aaaaagtggc accgagtcgg tgcttttttg ttttagagct

      361 agaaatagca agttaaaata aggctagtcc gtttttagcg cgtgcgccaa ttctgcagac

      421 aaatggctct agaggtaccc gttacataac ttacggtaaa tggcccgcct ggctgaccgc

      481 ccaacgaccc ccgcccattg acgtcaatag taacgccaat agggactttc cattgacgtc

      541 aatgggtgga gtatttacgg taaactgccc acttggcagt acatcaagtg tatcatatgc

      601 caagtacgcc ccctattgac gtcaatgacg gtaaatggcc cgcctggcat tgtgcccagt

      661 acatgacctt atgggacttt cctacttggc agtacatcta cgtattagtc atcgctatta

      721 ccatggtcga ggtgagcccc acgttctgct tcactctccc catctccccc ccctccccac

      781 ccccaatttt gtatttattt attttttaat tattttgtgc agcgatgggg gcgggggggg

      841 ggggggggcg cgcgccaggc ggggcggggc ggggcgaggg gcggggcggg gcgaggcgga

      901 gaggtgcggc ggcagccaat cagagcggcg cgctccgaaa gtttcctttt atggcgaggc

      961 ggcggcggcg gcggccctat aaaaagcgaa gcgcgcggcg ggcgggagtc gctgcgacgc

     1021 tgccttcgcc ccgtgccccg ctccgccgcc gcctcgcgcc gcccgccccg gctctgactg

     1081 accgcgttac tcccacaggt gagcgggcgg gacggccctt ctcctccggg ctgtaattag

     1141 ctgagcaaga ggtaagggtt taagggatgg ttggttggtg gggtattaat gtttaattac

     1201 ctggagcacc tgcctgaaat cacttttttt caggttggac cggtgccacc atggactata

     1261 aggaccacga cggagactac aaggatcatg atattgatta caaagacgat gacgataaga

     1321 tggccccaaa gaagaagcgg aaggtcggta tccacggagt cccagcagcc gacaagaagt

     1381 acagcatcgg cctggacatc ggcaccaact ctgtgggctg ggccgtgatc accgacgagt

     1441 acaaggtgcc cagcaagaaa ttcaaggtgc tgggcaacac cgaccggcac agcatcaaga

     1501 agaacctgat cggagccctg ctgttcgaca gcggcgaaac agccgaggcc acccggctga

     1561 agagaaccgc cagaagaaga tacaccagac ggaagaaccg gatctgctat ctgcaagaga

     1621 tcttcagcaa cgagatggcc aaggtggacg acagcttctt ccacagactg gaagagtcct

     1681 tcctggtgga agaggataag aagcacgagc ggcaccccat cttcggcaac atcgtggacg

     1741 aggtggccta ccacgagaag taccccacca tctaccacct gagaaagaaa ctggtggaca

     1801 gcaccgacaa ggccgacctg cggctgatct atctggccct ggcccacatg atcaagttcc

     1861 ggggccactt cctgatcgag ggcgacctga accccgacaa cagcgacgtg gacaagctgt

     1921 tcatccagct ggtgcagacc tacaaccagc tgttcgagga aaaccccatc aacgccagcg

     1981 gcgtggacgc caaggccatc ctgtctgcca gactgagcaa gagcagacgg ctggaaaatc

     2041 tgatcgccca gctgcccggc gagaagaaga atggcctgtt cggaaacctg attgccctga

     2101 gcctgggcct gacccccaac ttcaagagca acttcgacct ggccgaggat gccaaactgc

     2161 agctgagcaa ggacacctac gacgacgacc tggacaacct gctggcccag atcggcgacc

     2221 agtacgccga cctgtttctg gccgccaaga acctgtccga cgccatcctg ctgagcgaca

     2281 tcctgagagt gaacaccgag atcaccaagg cccccctgag cgcctctatg atcaagagat

     2341 acgacgagca ccaccaggac ctgaccctgc tgaaagctct cgtgcggcag cagctgcctg

     2401 agaagtacaa agagattttc ttcgaccaga gcaagaacgg ctacgccggc tacattgacg

     2461 gcggagccag ccaggaagag ttctacaagt tcatcaagcc catcctggaa aagatggacg

     2521 gcaccgagga actgctcgtg aagctgaaca gagaggacct gctgcggaag cagcggacct

     2581 tcgacaacgg cagcatcccc caccagatcc acctgggaga gctgcacgcc attctgcggc

     2641 ggcaggaaga tttttaccca ttcctgaagg acaaccggga aaagatcgag aagatcctga

     2701 ccttccgcat cccctactac gtgggccctc tggccagggg aaacagcaga ttcgcctgga

     2761 tgaccagaaa gagcgaggaa accatcaccc cctggaactt cgaggaagtg gtggacaagg

     2821 gcgcttccgc ccagagcttc atcgagcgga tgaccaactt cgataagaac ctgcccaacg

     2881 agaaggtgct gcccaagcac agcctgctgt acgagtactt caccgtgtat aacgagctga

     2941 ccaaagtgaa atacgtgacc gagggaatga gaaagcccgc cttcctgagc ggcgagcaga

     3001 aaaaggccat cgtggacctg ctgttcaaga ccaaccggaa agtgaccgtg aagcagctga

     3061 aagaggacta cttcaagaaa atcgagtgct tcgactccgt ggaaatctcc ggcgtggaag

     3121 atcggttcaa cgcctccctg ggcacatacc acgatctgct gaaaattatc aaggacaagg

     3181 acttcctgga caatgaggaa aacgaggaca ttctggaaga tatcgtgctg accctgacac

     3241 tgtttgagga cagagagatg atcgaggaac ggctgaaaac ctatgcccac ctgttcgacg

     3301 acaaagtgat gaagcagctg aagcggcgga gatacaccgg ctggggcagg ctgagccgga

     3361 agctgatcaa cggcatccgg gacaagcagt ccggcaagac aatcctggat ttcctgaagt

     3421 ccgacggctt cgccaacaga aacttcatgc agctgatcca cgacgacagc ctgaccttta

     3481 aagaggacat ccagaaagcc caggtgtccg gccagggcga tagcctgcac gagcacattg

     3541 ccaatctggc cggcagcccc gccattaaga agggcatcct gcagacagtg aaggtggtgg

     3601 acgagctcgt gaaagtgatg ggccggcaca agcccgagaa catcgtgatc gaaatggcca

     3661 gagagaacca gaccacccag aagggacaga agaacagccg cgagagaatg aagcggatcg

     3721 aagagggcat caaagagctg ggcagccaga tcctgaaaga acaccccgtg gaaaacaccc

     3781 agctgcagaa cgagaagctg tacctgtact acctgcagaa tgggcgggat atgtacgtgg

     3841 accaggaact ggacatcaac cggctgtccg actacgatgt ggaccatatc gtgcctcaga

     3901 gctttctgaa ggacgactcc atcgacaaca aggtgctgac cagaagcgac aagaaccggg

     3961 gcaagagcga caacgtgccc tccgaagagg tcgtgaagaa gatgaagaac tactggcggc

     4021 agctgctgaa cgccaagctg attacccaga gaaagttcga caatctgacc aaggccgaga

     4081 gaggcggcct gagcgaactg gataaggccg gcttcatcaa gagacagctg gtggaaaccc

     4141 ggcagatcac aaagcacgtg gcacagatcc tggactcccg gatgaacact aagtacgacg

     4201 agaatgacaa gctgatccgg gaagtgaaag tgatcaccct gaagtccaag ctggtgtccg

     4261 atttccggaa ggatttccag ttttacaaag tgcgcgagat caacaactac caccacgccc

     4321 acgacgccta cctgaacgcc gtcgtgggaa ccgccctgat caaaaagtac cctaagctgg

     4381 aaagcgagtt cgtgtacggc gactacaagg tgtacgacgt gcggaagatg atcgccaaga

     4441 gcgagcagga aatcggcaag gctaccgcca agtacttctt ctacagcaac atcatgaact

     4501 ttttcaagac cgagattacc ctggccaacg gcgagatccg gaagcggcct ctgatcgaga

     4561 caaacggcga aaccggggag atcgtgtggg ataagggccg ggattttgcc accgtgcgga

     4621 aagtgctgag catgccccaa gtgaatatcg tgaaaaagac cgaggtgcag acaggcggct

     4681 tcagcaaaga gtctatcctg cccaagagga acagcgataa gctgatcgcc agaaagaagg

     4741 actgggaccc taagaagtac ggcggcttcg acagccccac cgtggcctat tctgtgctgg

     4801 tggtggccaa agtggaaaag ggcaagtcca agaaactgaa gagtgtgaaa gagctgctgg

     4861 ggatcaccat catggaaaga agcagcttcg agaagaatcc catcgacttt ctggaagcca

     4921 agggctacaa agaagtgaaa aaggacctga tcatcaagct gcctaagtac tccctgttcg

     4981 agctggaaaa cggccggaag agaatgctgg cctctgccgg cgaactgcag aagggaaacg

     5041 aactggccct gccctccaaa tatgtgaact tcctgtacct ggccagccac tatgagaagc

     5101 tgaagggctc ccccgaggat aatgagcaga aacagctgtt tgtggaacag cacaagcact

     5161 acctggacga gatcatcgag cagatcagcg agttctccaa gagagtgatc ctggccgacg

     5221 ctaatctgga caaagtgctg tccgcctaca acaagcaccg ggataagccc atcagagagc

     5281 aggccgagaa tatcatccac ctgtttaccc tgaccaatct gggagcccct gccgccttca

     5341 agtactttga caccaccatc gaccggaaga ggtacaccag caccaaagag gtgctggacg

     5401 ccaccctgat ccaccagagc atcaccggcc tgtacgagac acggatcgac ctgtctcagc

     5461 tgggaggcga caaaaggccg gcggccacga aaaaggccgg ccaggcaaaa aagaaaaagg

     5521 aattcggcag tggagagggc agaggaagtc tgctaacatg cggtgacgtc gaggagaatc

     5581 ctggcccagt gagcaagggc gaggagctgt tcaccggggt ggtgcccatc ctggtcgagc

     5641 tggacggcga cgtaaacggc cacaagttca gcgtgtccgg cgagggcgag ggcgatgcca

     5701 cctacggcaa gctgaccctg aagttcatct gcaccaccgg caagctgccc gtgccctggc

     5761 ccaccctcgt gaccaccctg acctacggcg tgcagtgctt cagccgctac cccgaccaca

     5821 tgaagcagca cgacttcttc aagtccgcca tgcccgaagg ctacgtccag gagcgcacca

     5881 tcttcttcaa ggacgacggc aactacaaga cccgcgccga ggtgaagttc gagggcgaca

     5941 ccctggtgaa ccgcatcgag ctgaagggca tcgacttcaa ggaggacggc aacatcctgg

     6001 ggcacaagct ggagtacaac tacaacagcc acaacgtcta tatcatggcc gacaagcaga

     6061 agaacggcat caaggtgaac ttcaagatcc gccacaacat cgaggacggc agcgtgcagc

     6121 tcgccgacca ctaccagcag aacaccccca tcggcgacgg ccccgtgctg ctgcccgaca

     6181 accactacct gagcacccag tccgccctga gcaaagaccc caacgagaag cgcgatcaca

     6241 tggtcctgct ggagttcgtg accgccgccg ggatcactct cggcatggac gagctgtaca

     6301 aggaattcta actagagctc gctgatcagc ctcgactgtg ccttctagtt gccagccatc

     6361 tgttgtttgc ccctcccccg tgccttcctt gaccctggaa ggtgccactc ccactgtcct

     6421 ttcctaataa aatgaggaaa ttgcatcgca ttgtctgagt aggtgtcatt ctattctggg

     6481 gggtggggtg gggcaggaca gcaaggggga ggattgggaa gagaatagca ggcatgctgg

     6541 ggagcggccg caggaacccc tagtgatgga gttggccact ccctctctgc gcgctcgctc

     6601 gctcactgag gccgggcgac caaaggtcgc ccgacgcccg ggctttgccc gggcggcctc

     6661 agtgagcgag cgagcgcgca gctgcctgca ggggcgcctg atgcggtatt ttctccttac

     6721 gcatctgtgc ggtatttcac accgcatacg tcaaagcaac catagtacgc gccctgtagc

     6781 ggcgcattaa gcgcggcggg tgtggtggtt acgcgcagcg tgaccgctac acttgccagc

     6841 gccctagcgc ccgctccttt cgctttcttc ccttcctttc tcgccacgtt cgccggcttt

     6901 ccccgtcaag ctctaaatcg ggggctccct ttagggttcc gatttagtgc tttacggcac

     6961 ctcgacccca aaaaacttga tttgggtgat ggttcacgta gtgggccatc gccctgatag

     7021 acggtttttc gccctttgac gttggagtcc acgttcttta atagtggact cttgttccaa

     7081 actggaacaa cactcaaccc tatctcgggc tattcttttg atttataagg gattttgccg

     7141 atttcggcct attggttaaa aaatgagctg atttaacaaa aatttaacgc gaattttaac

     7201 aaaatattaa cgtttacaat tttatggtgc actctcagta caatctgctc tgatgccgca

     7261 tagttaagcc agccccgaca cccgccaaca cccgctgacg cgccctgacg ggcttgtctg

     7321 ctcccggcat ccgcttacag acaagctgtg accgtctccg ggagctgcat gtgtcagagg

     7381 ttttcaccgt catcaccgaa acgcgcgaga cgaaagggcc tcgtgatacg cctattttta

     7441 taggttaatg tcatgataat aatggtttct tagacgtcag gtggcacttt tcggggaaat

     7501 gtgcgcggaa cccctatttg tttatttttc taaatacatt caaatatgta tccgctcatg

     7561 agacaataac cctgataaat gcttcaataa tattgaaaaa ggaagagtat gagtattcaa

     7621 catttccgtg tcgcccttat tccctttttt gcggcatttt gccttcctgt ttttgctcac

     7681 ccagaaacgc tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg agtgggttac

     7741 atcgaactgg atctcaacag cggtaagatc cttgagagtt ttcgccccga agaacgtttt

     7801 ccaatgatga gcacttttaa agttctgcta tgtggcgcgg tattatcccg tattgacgcc

     7861 gggcaagagc aactcggtcg ccgcatacac tattctcaga atgacttggt tgagtactca

     7921 ccagtcacag aaaagcatct tacggatggc atgacagtaa gagaattatg cagtgctgcc

     7981 ataaccatga gtgataacac tgcggccaac ttacttctga caacgatcgg aggaccgaag

     8041 gagctaaccg cttttttgca caacatgggg gatcatgtaa ctcgccttga tcgttgggaa

     8101 ccggagctga atgaagccat accaaacgac gagcgtgaca ccacgatgcc tgtagcaatg

     8161 gcaacaacgt tgcgcaaact attaactggc gaactactta ctctagcttc ccggcaacaa

     8221 ttaatagact ggatggaggc ggataaagtt gcaggaccac ttctgcgctc ggcccttccg

     8281 gctggctggt ttattgctga taaatctgga gccggtgagc gtggaagccg cggtatcatt

     8341 gcagcactgg ggccagatgg taagccctcc cgtatcgtag ttatctacac gacggggagt

     8401 caggcaacta tggatgaacg aaatagacag atcgctgaga taggtgcctc actgattaag

     8461 cattggtaac tgtcagacca agtttactca tatatacttt agattgattt aaaacttcat

     8521 ttttaattta aaaggatcta ggtgaagatc ctttttgata atctcatgac caaaatccct

     8581 taacgtgagt tttcgttcca ctgagcgtca gaccccgtag aaaagatcaa aggatcttct

     8641 tgagatcctt tttttctgcg cgtaatctgc tgcttgcaaa caaaaaaacc accgctacca

     8701 gcggtggttt gtttgccgga tcaagagcta ccaactcttt ttccgaaggt aactggcttc

     8761 agcagagcgc agataccaaa tactgtcctt ctagtgtagc cgtagttagg ccaccacttc

     8821 aagaactctg tagcaccgcc tacatacctc gctctgctaa tcctgttacc agtggctgct

     8881 gccagtggcg ataagtcgtg tcttaccggg ttggactcaa gacgatagtt accggataag

     8941 gcgcagcggt cgggctgaac ggggggttcg tgcacacagc ccagcttgga gcgaacgacc

     9001 tacaccgaac tgagatacct acagcgtgag ctatgagaaa gcgccacgct tcccgaaggg

     9061 agaaaggcgg acaggtatcc ggtaagcggc agggtcggaa caggagagcg cacgagggag

     9121 cttccagggg gaaacgcctg gtatctttat agtcctgtcg ggtttcgcca cctctgactt

     9181 gagcgtcgat ttttgtgatg ctcgtcaggg gggcggagcc tatggaaaaa cgccagcaac

     9241 gcggcctttt tacggttcct ggccttttgc tggccttttg ctcacatgt

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart