pX459 V2.0 Plasmid

$136.00

  • Model: PVT6306
  • 50 Units in Stock
Ask a question


Add to Cart:

pX459 V2.0 Plasmid

PVT6306       2ug
 

 

pX459 V2.0 Plasmid Information

Prokaryotic resistance: ampicillin Amp

Screening markers: purinomycin Puro

Cloned strain: Escherichia coli Stbl3

Culture conditions: 37 degrees centigrade

Use:CRISPR-CAS15-sgRNA plasmid

 

pX459 V2.0 Plasmid Description

PX459 V2.0 Plasmid is a mammalian cell Cas9 and gRNA gene knockout plasmids

pX459-V2.0-plasmid

 

pX459 V2.0 Plasmid Sequence

LOCUS       Exported                9175 bp ds-DNA     circular SYN 25-JUL-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..9175

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1..241

                     /label=U6 promoter

                     /note="RNA polymerase III promoter for human U6 snRNA"

     primer_bind     169..192

                     /label=U6

     misc_RNA        268..343

                     /label=gRNA scaffold

                     /note="guide RNA scaffold for the CRISPR/Cas9 system"

     promoter        727..1004

                     /label=chicken beta-actin promoter

     CDS             1254..1319

                     /codon_start=1

                     /product="three tandem FLAG(R) epitope tags, followed by an

                     enterokinase cleavage site"

                     /label=3xFLAG

                     /translation="DYKDHDGDYKDHDIDYKDDDDK"

     CDS             1326..1346

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     CDS             1371..5471

                     /codon_start=1

                     /product="Cas9 (Csn1) endonuclease from the Streptococcus 

                     pyogenes Type II CRISPR/Cas system"

                     /label=Cas9

                     /note="generates RNA-guided double strand breaks in DNA"

                     /translation="DKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKN

                     LIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESF

                     LVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKF

                     RGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLE

                     NLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQI

                     GDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQ

                     QLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR

                     KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGN

                     SRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF

                     TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDS

                     VEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERL

                     KTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQ

                     LIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH

                     KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYL

                     YYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPS

                     EEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV

                     AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLN

                     AVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTE

                     ITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKE

                     SILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGIT

                     IMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNEL

                     ALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA

                     NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLD

                     ATLIHQSITGLYETRIDLSQLGGD"

     CDS             5472..5519

                     /codon_start=1

                     /product="bipartite nuclear localization signal from 

                     nucleoplasmin"

                     /label=nucleoplasmin NLS

                     /translation="KRPAATKKAGQAKKKK"

     CDS             5535..5588

                     /codon_start=1

                     /product="2A peptide from Thosea asigna virus capsid 

                     protein"

                     /label=T2A

                     /note="Eukaryotic ribosomes fail to insert a peptide bond 

                     between the Gly and Pro residues, yielding separate 

                     polypeptides."

                     /translation="EGRGSLLTCGDVEENPGP"

     primer_bind     complement(5576..5594)

                     /label=T2A-R

     CDS             5589..6188

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /label=PuroR

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     polyA_signal    6222..6429

                     /label=bGH poly(A) signal

                     /note="bovine growth hormone polyadenylation signal"

     rep_origin      6653..7108

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        7390..7494

                     /gene="bla"

                     /label=AmpR promoter

     CDS             7495..8355

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      8526..9114

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gagggcctat ttcccatgat tccttcatat ttgcatatac gatacaaggc tgttagagag

       61 ataattggaa ttaatttgac tgtaaacaca aagatattag tacaaaatac gtgacgtaga

      121 aagtaataat ttcttgggta gtttgcagtt ttaaaattat gttttaaaat ggactatcat

      181 atgcttaccg taacttgaaa gtatttcgat ttcttggctt tatatatctt gtggaaagga

      241 cgaaacaccg ggtcttcgag aagacctgtt ttagagctag aaatagcaag ttaaaataag

      301 gctagtccgt tatcaacttg aaaaagtggc accgagtcgg tgcttttttg ttttagagct

      361 agaaatagca agttaaaata aggctagtcc gtttttagcg cgtgcgccaa ttctgcagac

      421 aaatggctct agaggtaccc gttacataac ttacggtaaa tggcccgcct ggctgaccgc

      481 ccaacgaccc ccgcccattg acgtcaatag taacgccaat agggactttc cattgacgtc

      541 aatgggtgga gtatttacgg taaactgccc acttggcagt acatcaagtg tatcatatgc

      601 caagtacgcc ccctattgac gtcaatgacg gtaaatggcc cgcctggcat tgtgcccagt

      661 acatgacctt atgggacttt cctacttggc agtacatcta cgtattagtc atcgctatta

      721 ccatggtcga ggtgagcccc acgttctgct tcactctccc catctccccc ccctccccac

      781 ccccaatttt gtatttattt attttttaat tattttgtgc agcgatgggg gcgggggggg

      841 ggggggggcg cgcgccaggc ggggcggggc ggggcgaggg gcggggcggg gcgaggcgga

      901 gaggtgcggc ggcagccaat cagagcggcg cgctccgaaa gtttcctttt atggcgaggc

      961 ggcggcggcg gcggccctat aaaaagcgaa gcgcgcggcg ggcgggagtc gctgcgacgc

     1021 tgccttcgcc ccgtgccccg ctccgccgcc gcctcgcgcc gcccgccccg gctctgactg

     1081 accgcgttac tcccacaggt gagcgggcgg gacggccctt ctcctccggg ctgtaattag

     1141 ctgagcaaga ggtaagggtt taagggatgg ttggttggtg gggtattaat gtttaattac

     1201 ctggagcacc tgcctgaaat cacttttttt caggttggac cggtgccacc atggactata

     1261 aggaccacga cggagactac aaggatcatg atattgatta caaagacgat gacgataaga

     1321 tggccccaaa gaagaagcgg aaggtcggta tccacggagt cccagcagcc gacaagaagt

     1381 acagcatcgg cctggacatc ggcaccaact ctgtgggctg ggccgtgatc accgacgagt

     1441 acaaggtgcc cagcaagaaa ttcaaggtgc tgggcaacac cgaccggcac agcatcaaga

     1501 agaacctgat cggagccctg ctgttcgaca gcggcgaaac agccgaggcc acccggctga

     1561 agagaaccgc cagaagaaga tacaccagac ggaagaaccg gatctgctat ctgcaagaga

     1621 tcttcagcaa cgagatggcc aaggtggacg acagcttctt ccacagactg gaagagtcct

     1681 tcctggtgga agaggataag aagcacgagc ggcaccccat cttcggcaac atcgtggacg

     1741 aggtggccta ccacgagaag taccccacca tctaccacct gagaaagaaa ctggtggaca

     1801 gcaccgacaa ggccgacctg cggctgatct atctggccct ggcccacatg atcaagttcc

     1861 ggggccactt cctgatcgag ggcgacctga accccgacaa cagcgacgtg gacaagctgt

     1921 tcatccagct ggtgcagacc tacaaccagc tgttcgagga aaaccccatc aacgccagcg

     1981 gcgtggacgc caaggccatc ctgtctgcca gactgagcaa gagcagacgg ctggaaaatc

     2041 tgatcgccca gctgcccggc gagaagaaga atggcctgtt cggaaacctg attgccctga

     2101 gcctgggcct gacccccaac ttcaagagca acttcgacct ggccgaggat gccaaactgc

     2161 agctgagcaa ggacacctac gacgacgacc tggacaacct gctggcccag atcggcgacc

     2221 agtacgccga cctgtttctg gccgccaaga acctgtccga cgccatcctg ctgagcgaca

     2281 tcctgagagt gaacaccgag atcaccaagg cccccctgag cgcctctatg atcaagagat

     2341 acgacgagca ccaccaggac ctgaccctgc tgaaagctct cgtgcggcag cagctgcctg

     2401 agaagtacaa agagattttc ttcgaccaga gcaagaacgg ctacgccggc tacattgacg

     2461 gcggagccag ccaggaagag ttctacaagt tcatcaagcc catcctggaa aagatggacg

     2521 gcaccgagga actgctcgtg aagctgaaca gagaggacct gctgcggaag cagcggacct

     2581 tcgacaacgg cagcatcccc caccagatcc acctgggaga gctgcacgcc attctgcggc

     2641 ggcaggaaga tttttaccca ttcctgaagg acaaccggga aaagatcgag aagatcctga

     2701 ccttccgcat cccctactac gtgggccctc tggccagggg aaacagcaga ttcgcctgga

     2761 tgaccagaaa gagcgaggaa accatcaccc cctggaactt cgaggaagtg gtggacaagg

     2821 gcgcttccgc ccagagcttc atcgagcgga tgaccaactt cgataagaac ctgcccaacg

     2881 agaaggtgct gcccaagcac agcctgctgt acgagtactt caccgtgtat aacgagctga

     2941 ccaaagtgaa atacgtgacc gagggaatga gaaagcccgc cttcctgagc ggcgagcaga

     3001 aaaaggccat cgtggacctg ctgttcaaga ccaaccggaa agtgaccgtg aagcagctga

     3061 aagaggacta cttcaagaaa atcgagtgct tcgactccgt ggaaatctcc ggcgtggaag

     3121 atcggttcaa cgcctccctg ggcacatacc acgatctgct gaaaattatc aaggacaagg

     3181 acttcctgga caatgaggaa aacgaggaca ttctggaaga tatcgtgctg accctgacac

     3241 tgtttgagga cagagagatg atcgaggaac ggctgaaaac ctatgcccac ctgttcgacg

     3301 acaaagtgat gaagcagctg aagcggcgga gatacaccgg ctggggcagg ctgagccgga

     3361 agctgatcaa cggcatccgg gacaagcagt ccggcaagac aatcctggat ttcctgaagt

     3421 ccgacggctt cgccaacaga aacttcatgc agctgatcca cgacgacagc ctgaccttta

     3481 aagaggacat ccagaaagcc caggtgtccg gccagggcga tagcctgcac gagcacattg

     3541 ccaatctggc cggcagcccc gccattaaga agggcatcct gcagacagtg aaggtggtgg

     3601 acgagctcgt gaaagtgatg ggccggcaca agcccgagaa catcgtgatc gaaatggcca

     3661 gagagaacca gaccacccag aagggacaga agaacagccg cgagagaatg aagcggatcg

     3721 aagagggcat caaagagctg ggcagccaga tcctgaaaga acaccccgtg gaaaacaccc

     3781 agctgcagaa cgagaagctg tacctgtact acctgcagaa tgggcgggat atgtacgtgg

     3841 accaggaact ggacatcaac cggctgtccg actacgatgt ggaccatatc gtgcctcaga

     3901 gctttctgaa ggacgactcc atcgacaaca aggtgctgac cagaagcgac aagaaccggg

     3961 gcaagagcga caacgtgccc tccgaagagg tcgtgaagaa gatgaagaac tactggcggc

     4021 agctgctgaa cgccaagctg attacccaga gaaagttcga caatctgacc aaggccgaga

     4081 gaggcggcct gagcgaactg gataaggccg gcttcatcaa gagacagctg gtggaaaccc

     4141 ggcagatcac aaagcacgtg gcacagatcc tggactcccg gatgaacact aagtacgacg

     4201 agaatgacaa gctgatccgg gaagtgaaag tgatcaccct gaagtccaag ctggtgtccg

     4261 atttccggaa ggatttccag ttttacaaag tgcgcgagat caacaactac caccacgccc

     4321 acgacgccta cctgaacgcc gtcgtgggaa ccgccctgat caaaaagtac cctaagctgg

     4381 aaagcgagtt cgtgtacggc gactacaagg tgtacgacgt gcggaagatg atcgccaaga

     4441 gcgagcagga aatcggcaag gctaccgcca agtacttctt ctacagcaac atcatgaact

     4501 ttttcaagac cgagattacc ctggccaacg gcgagatccg gaagcggcct ctgatcgaga

     4561 caaacggcga aaccggggag atcgtgtggg ataagggccg ggattttgcc accgtgcgga

     4621 aagtgctgag catgccccaa gtgaatatcg tgaaaaagac cgaggtgcag acaggcggct

     4681 tcagcaaaga gtctatcctg cccaagagga acagcgataa gctgatcgcc agaaagaagg

     4741 actgggaccc taagaagtac ggcggcttcg acagccccac cgtggcctat tctgtgctgg

     4801 tggtggccaa agtggaaaag ggcaagtcca agaaactgaa gagtgtgaaa gagctgctgg

     4861 ggatcaccat catggaaaga agcagcttcg agaagaatcc catcgacttt ctggaagcca

     4921 agggctacaa agaagtgaaa aaggacctga tcatcaagct gcctaagtac tccctgttcg

     4981 agctggaaaa cggccggaag agaatgctgg cctctgccgg cgaactgcag aagggaaacg

     5041 aactggccct gccctccaaa tatgtgaact tcctgtacct ggccagccac tatgagaagc

     5101 tgaagggctc ccccgaggat aatgagcaga aacagctgtt tgtggaacag cacaagcact

     5161 acctggacga gatcatcgag cagatcagcg agttctccaa gagagtgatc ctggccgacg

     5221 ctaatctgga caaagtgctg tccgcctaca acaagcaccg ggataagccc atcagagagc

     5281 aggccgagaa tatcatccac ctgtttaccc tgaccaatct gggagcccct gccgccttca

     5341 agtactttga caccaccatc gaccggaaga ggtacaccag caccaaagag gtgctggacg

     5401 ccaccctgat ccaccagagc atcaccggcc tgtacgagac acggatcgac ctgtctcagc

     5461 tgggaggcga caaaaggccg gcggccacga aaaaggccgg ccaggcaaaa aagaaaaagg

     5521 aattcggcag tggagagggc agaggaagtc tgctaacatg cggtgacgtc gaggagaatc

     5581 ctggcccaat gaccgagtac aagcccacgg tgcgcctcgc cacccgcgac gacgtcccca

     5641 gggccgtacg caccctcgcc gccgcgttcg ccgactaccc cgccacgcgc cacaccgtcg

     5701 atccggaccg ccacatcgag cgggtcaccg agctgcaaga actcttcctc acgcgcgtcg

     5761 ggctcgacat cggcaaggtg tgggtcgcgg acgacggcgc cgcggtggcg gtctggacca

     5821 cgccggagag cgtcgaagcg ggggcggtgt tcgccgagat cggcccgcgc atggccgagt

     5881 tgagcggttc ccggctggcc gcgcagcaac agatggaagg cctcctggcg ccgcaccggc

     5941 ccaaggagcc cgcgtggttc ctggccaccg tcggagtctc gcccgaccac cagggcaagg

     6001 gtctgggcag cgccgtcgtg ctccccggag tggaggcggc cgagcgcgcc ggggtgcccg

     6061 ccttcctgga gacctccgcg ccccgcaacc tccccttcta cgagcggctc ggcttcaccg

     6121 tcaccgccga cgtcgaggtg cccgaaggac cgcgcacctg gtgcatgacc cgcaagcccg

     6181 gtgcctgaga attctaacta gagctcgctg atcagcctcg actgtgcctt ctagttgcca

     6241 gccatctgtt gtttgcccct cccccgtgcc ttccttgacc ctggaaggtg ccactcccac

     6301 tgtcctttcc taataaaatg aggaaattgc atcgcattgt ctgagtaggt gtcattctat

     6361 tctggggggt ggggtggggc aggacagcaa gggggaggat tgggaagaga atagcaggca

     6421 tgctggggag cggccgcagg aacccctagt gatggagttg gccactccct ctctgcgcgc

     6481 tcgctcgctc actgaggccg ggcgaccaaa ggtcgcccga cgcccgggct ttgcccgggc

     6541 ggcctcagtg agcgagcgag cgcgcagctg cctgcagggg cgcctgatgc ggtattttct

     6601 ccttacgcat ctgtgcggta tttcacaccg catacgtcaa agcaaccata gtacgcgccc

     6661 tgtagcggcg cattaagcgc ggcgggtgtg gtggttacgc gcagcgtgac cgctacactt

     6721 gccagcgccc tagcgcccgc tcctttcgct ttcttccctt cctttctcgc cacgttcgcc

     6781 ggctttcccc gtcaagctct aaatcggggg ctccctttag ggttccgatt tagtgcttta

     6841 cggcacctcg accccaaaaa acttgatttg ggtgatggtt cacgtagtgg gccatcgccc

     6901 tgatagacgg tttttcgccc tttgacgttg gagtccacgt tctttaatag tggactcttg

     6961 ttccaaactg gaacaacact caaccctatc tcgggctatt cttttgattt ataagggatt

     7021 ttgccgattt cggcctattg gttaaaaaat gagctgattt aacaaaaatt taacgcgaat

     7081 tttaacaaaa tattaacgtt tacaatttta tggtgcactc tcagtacaat ctgctctgat

     7141 gccgcatagt taagccagcc ccgacacccg ccaacacccg ctgacgcgcc ctgacgggct

     7201 tgtctgctcc cggcatccgc ttacagacaa gctgtgaccg tctccgggag ctgcatgtgt

     7261 cagaggtttt caccgtcatc accgaaacgc gcgagacgaa agggcctcgt gatacgccta

     7321 tttttatagg ttaatgtcat gataataatg gtttcttaga cgtcaggtgg cacttttcgg

     7381 ggaaatgtgc gcggaacccc tatttgttta tttttctaaa tacattcaaa tatgtatccg

     7441 ctcatgagac aataaccctg ataaatgctt caataatatt gaaaaaggaa gagtatgagt

     7501 attcaacatt tccgtgtcgc ccttattccc ttttttgcgg cattttgcct tcctgttttt

     7561 gctcacccag aaacgctggt gaaagtaaaa gatgctgaag atcagttggg tgcacgagtg

     7621 ggttacatcg aactggatct caacagcggt aagatccttg agagttttcg ccccgaagaa

     7681 cgttttccaa tgatgagcac ttttaaagtt ctgctatgtg gcgcggtatt atcccgtatt

     7741 gacgccgggc aagagcaact cggtcgccgc atacactatt ctcagaatga cttggttgag

     7801 tactcaccag tcacagaaaa gcatcttacg gatggcatga cagtaagaga attatgcagt

     7861 gctgccataa ccatgagtga taacactgcg gccaacttac ttctgacaac gatcggagga

     7921 ccgaaggagc taaccgcttt tttgcacaac atgggggatc atgtaactcg ccttgatcgt

     7981 tgggaaccgg agctgaatga agccatacca aacgacgagc gtgacaccac gatgcctgta

     8041 gcaatggcaa caacgttgcg caaactatta actggcgaac tacttactct agcttcccgg

     8101 caacaattaa tagactggat ggaggcggat aaagttgcag gaccacttct gcgctcggcc

     8161 cttccggctg gctggtttat tgctgataaa tctggagccg gtgagcgtgg aagccgcggt

     8221 atcattgcag cactggggcc agatggtaag ccctcccgta tcgtagttat ctacacgacg

     8281 gggagtcagg caactatgga tgaacgaaat agacagatcg ctgagatagg tgcctcactg

     8341 attaagcatt ggtaactgtc agaccaagtt tactcatata tactttagat tgatttaaaa

     8401 cttcattttt aatttaaaag gatctaggtg aagatccttt ttgataatct catgaccaaa

     8461 atcccttaac gtgagttttc gttccactga gcgtcagacc ccgtagaaaa gatcaaagga

     8521 tcttcttgag atcctttttt tctgcgcgta atctgctgct tgcaaacaaa aaaaccaccg

     8581 ctaccagcgg tggtttgttt gccggatcaa gagctaccaa ctctttttcc gaaggtaact

     8641 ggcttcagca gagcgcagat accaaatact gtccttctag tgtagccgta gttaggccac

     8701 cacttcaaga actctgtagc accgcctaca tacctcgctc tgctaatcct gttaccagtg

     8761 gctgctgcca gtggcgataa gtcgtgtctt accgggttgg actcaagacg atagttaccg

     8821 gataaggcgc agcggtcggg ctgaacgggg ggttcgtgca cacagcccag cttggagcga

     8881 acgacctaca ccgaactgag atacctacag cgtgagctat gagaaagcgc cacgcttccc

     8941 gaagggagaa aggcggacag gtatccggta agcggcaggg tcggaacagg agagcgcacg

     9001 agggagcttc cagggggaaa cgcctggtat ctttatagtc ctgtcgggtt tcgccacctc

     9061 tgacttgagc gtcgattttt gtgatgctcg tcaggggggc ggagcctatg gaaaaacgcc

     9121 agcaacgcgg cctttttacg gttcctggcc ttttgctggc cttttgctca catgt

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart