pX459M

$193.00

  • Model: PVT10910
  • 50 Units in Stock
Ask a question


Add to Cart:

pX459M

Catalog No. PVT10910
Packing 2ug

 

pX459M Information
Function Mammal Editing plasmids
Resistance /
Screen /
Strain /
Culture temperature
Replicon
Copy
Promoter
Induction
Forward primer
Reverse primer

 

pX459M Description

pX459M

 

pX459M Sequence

LOCUS       Exported                9211 bp ds-DNA     circular SYN 24-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9211)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 24, 2017  

FEATURES             Location/Qualifiers

     source          1..9211

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1..241

                     /label=U6 promoter

                     /note="RNA polymerase III promoter for human U6 snRNA"

     misc_RNA        268..343

                     /label=gRNA scaffold

                     /note="guide RNA scaffold for the Streptococcus pyogenes 

                     CRISPR/Cas9 system"

     misc_feature    428..475

                     /label=MCS

     enhancer        476..761

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer; 

                     contains an 18-bp deletion relative to the standard CMV 

                     enhancer"

     promoter        763..1040

                     /label=chicken beta-actin promoter

     intron          1041..1269

                     /label=hybrid intron

                     /note="hybrid between chicken beta-actin (CBA) and minute 

                     virus of mice (MMV) introns (Gray et al., 2011)"

     CDS             1290..1355

                     /codon_start=1

                     /product="three tandem FLAG(R) epitope tags, followed by an

                     enterokinase cleavage site"

                     /label=3xFLAG

                     /translation="DYKDHDGDYKDHDIDYKDDDDK"

     CDS             1362..1382

                     /codon_start=1

                     /product="nuclear localization signal of SV40 (simian virus

                     40) large T antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     CDS             1407..5507

                     /codon_start=1

                     /product="Cas9 (Csn1) endonuclease from the Streptococcus 

                     pyogenes Type II CRISPR/Cas system"

                     /label=Cas9

                     /note="generates RNA-guided double strand breaks in DNA"

                     /translation="DKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKN

                     LIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESF

                     LVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKF

                     RGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLE

                     NLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQI

                     GDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQ

                     QLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR

                     KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGN

                     SRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF

                     TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDS

                     VEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERL

                     KTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQ

                     LIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH

                     KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYL

                     YYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPS

                     EEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV

                     AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLN

                     AVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTE

                     ITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKE

                     SILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGIT

                     IMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNEL

                     ALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA

                     NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLD

                     ATLIHQSITGLYETRIDLSQLGGD"

     CDS             5508..5555

                     /codon_start=1

                     /product="bipartite nuclear localization signal from 

                     nucleoplasmin"

                     /label=nucleoplasmin NLS

                     /translation="KRPAATKKAGQAKKKK"

     CDS             5571..5624

                     /codon_start=1

                     /product="2A peptide from Thosea asigna virus capsid 

                     protein"

                     /label=T2A

                     /note="Eukaryotic ribosomes fail to insert a peptide bond 

                     between the Gly and Pro residues, yielding separate 

                     polypeptides."

                     /translation="EGRGSLLTCGDVEENPGP"

     CDS             5625..6224

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /label=PuroR

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     polyA_signal    6258..6465

                     /label=bGH poly(A) signal

                     /note="bovine growth hormone polyadenylation signal"

     repeat_region   6474..6614

                     /label=AAV2 ITR

                     /note="inverted terminal repeat of adeno-associated virus 

                     serotype 2"

     rep_origin      6689..7144

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        7426..7530

                     /gene="bla"

                     /label=AmpR promoter

     CDS             7531..8391

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      8562..9150

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gagggcctat ttcccatgat tccttcatat ttgcatatac gatacaaggc tgttagagag

       61 ataattggaa ttaatttgac tgtaaacaca aagatattag tacaaaatac gtgacgtaga

      121 aagtaataat ttcttgggta gtttgcagtt ttaaaattat gttttaaaat ggactatcat

      181 atgcttaccg taacttgaaa gtatttcgat ttcttggctt tatatatctt gtggaaagga

      241 cgaaacaccg ggtcttcgag aagacctgtt ttagagctag aaatagcaag ttaaaataag

      301 gctagtccgt tatcaacttg aaaaagtggc accgagtcgg tgcttttttg ttttagagct

      361 agaaatagca agttaaaata aggctagtcc gtttttagcg cgtgcgccaa ttctgcagac

      421 aaatggctct agagtcgaca ctagtctcga gatcgataag cttcctagag gtacccgtta

      481 cataacttac ggtaaatggc ccgcctggct gaccgcccaa cgacccccgc ccattgacgt

      541 caatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa

      601 ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca

      661 atgacggtaa atggcccgcc tggcattgtg cccagtacat gaccttatgg gactttccta

      721 cttggcagta catctacgta ttagtcatcg ctattaccat ggtcgaggtg agccccacgt

      781 tctgcttcac tctccccatc tcccccccct ccccaccccc aattttgtat ttatttattt

      841 tttaattatt ttgtgcagcg atgggggcgg gggggggggg ggggcgcgcg ccaggcgggg

      901 cggggcgggg cgaggggcgg ggcggggcga ggcggagagg tgcggcggca gccaatcaga

      961 gcggcgcgct ccgaaagttt ccttttatgg cgaggcggcg gcggcggcgg ccctataaaa

     1021 agcgaagcgc gcggcgggcg ggagtcgctg cgacgctgcc ttcgccccgt gccccgctcc

     1081 gccgccgcct cgcgccgccc gccccggctc tgactgaccg cgttactccc acaggtgagc

     1141 gggcgggacg gcccttctcc tccgggctgt aattagctga gcaagaggta agggtttaag

     1201 ggatggttgg ttggtggggt attaatgttt aattacctgg agcacctgcc tgaaatcact

     1261 ttttttcagg ttggaccggt gccaccatgg actataagga ccacgacgga gactacaagg

     1321 atcatgatat tgattacaaa gacgatgacg ataagatggc cccaaagaag aagcggaagg

     1381 tcggtatcca cggagtccca gcagccgaca agaagtacag catcggcctg gacatcggca

     1441 ccaactctgt gggctgggcc gtgatcaccg acgagtacaa ggtgcccagc aagaaattca

     1501 aggtgctggg caacaccgac cggcacagca tcaagaagaa cctgatcgga gccctgctgt

     1561 tcgacagcgg cgaaacagcc gaggccaccc ggctgaagag aaccgccaga agaagataca

     1621 ccagacggaa gaaccggatc tgctatctgc aagagatctt cagcaacgag atggccaagg

     1681 tggacgacag cttcttccac agactggaag agtccttcct ggtggaagag gataagaagc

     1741 acgagcggca ccccatcttc ggcaacatcg tggacgaggt ggcctaccac gagaagtacc

     1801 ccaccatcta ccacctgaga aagaaactgg tggacagcac cgacaaggcc gacctgcggc

     1861 tgatctatct ggccctggcc cacatgatca agttccgggg ccacttcctg atcgagggcg

     1921 acctgaaccc cgacaacagc gacgtggaca agctgttcat ccagctggtg cagacctaca

     1981 accagctgtt cgaggaaaac cccatcaacg ccagcggcgt ggacgccaag gccatcctgt

     2041 ctgccagact gagcaagagc agacggctgg aaaatctgat cgcccagctg cccggcgaga

     2101 agaagaatgg cctgttcgga aacctgattg ccctgagcct gggcctgacc cccaacttca

     2161 agagcaactt cgacctggcc gaggatgcca aactgcagct gagcaaggac acctacgacg

     2221 acgacctgga caacctgctg gcccagatcg gcgaccagta cgccgacctg tttctggccg

     2281 ccaagaacct gtccgacgcc atcctgctga gcgacatcct gagagtgaac accgagatca

     2341 ccaaggcccc cctgagcgcc tctatgatca agagatacga cgagcaccac caggacctga

     2401 ccctgctgaa agctctcgtg cggcagcagc tgcctgagaa gtacaaagag attttcttcg

     2461 accagagcaa gaacggctac gccggctaca ttgacggcgg agccagccag gaagagttct

     2521 acaagttcat caagcccatc ctggaaaaga tggacggcac cgaggaactg ctcgtgaagc

     2581 tgaacagaga ggacctgctg cggaagcagc ggaccttcga caacggcagc atcccccacc

     2641 agatccacct gggagagctg cacgccattc tgcggcggca ggaagatttt tacccattcc

     2701 tgaaggacaa ccgggaaaag atcgagaaga tcctgacctt ccgcatcccc tactacgtgg

     2761 gccctctggc caggggaaac agcagattcg cctggatgac cagaaagagc gaggaaacca

     2821 tcaccccctg gaacttcgag gaagtggtgg acaagggcgc ttccgcccag agcttcatcg

     2881 agcggatgac caacttcgat aagaacctgc ccaacgagaa ggtgctgccc aagcacagcc

     2941 tgctgtacga gtacttcacc gtgtataacg agctgaccaa agtgaaatac gtgaccgagg

     3001 gaatgagaaa gcccgccttc ctgagcggcg agcagaaaaa ggccatcgtg gacctgctgt

     3061 tcaagaccaa ccggaaagtg accgtgaagc agctgaaaga ggactacttc aagaaaatcg

     3121 agtgcttcga ctccgtggaa atctccggcg tggaagatcg gttcaacgcc tccctgggca

     3181 cataccacga tctgctgaaa attatcaagg acaaggactt cctggacaat gaggaaaacg

     3241 aggacattct ggaagatatc gtgctgaccc tgacactgtt tgaggacaga gagatgatcg

     3301 aggaacggct gaaaacctat gcccacctgt tcgacgacaa agtgatgaag cagctgaagc

     3361 ggcggagata caccggctgg ggcaggctga gccggaagct gatcaacggc atccgggaca

     3421 agcagtccgg caagacaatc ctggatttcc tgaagtccga cggcttcgcc aacagaaact

     3481 tcatgcagct gatccacgac gacagcctga cctttaaaga ggacatccag aaagcccagg

     3541 tgtccggcca gggcgatagc ctgcacgagc acattgccaa tctggccggc agccccgcca

     3601 ttaagaaggg catcctgcag acagtgaagg tggtggacga gctcgtgaaa gtgatgggcc

     3661 ggcacaagcc cgagaacatc gtgatcgaaa tggccagaga gaaccagacc acccagaagg

     3721 gacagaagaa cagccgcgag agaatgaagc ggatcgaaga gggcatcaaa gagctgggca

     3781 gccagatcct gaaagaacac cccgtggaaa acacccagct gcagaacgag aagctgtacc

     3841 tgtactacct gcagaatggg cgggatatgt acgtggacca ggaactggac atcaaccggc

     3901 tgtccgacta cgatgtggac catatcgtgc ctcagagctt tctgaaggac gactccatcg

     3961 acaacaaggt gctgaccaga agcgacaaga accggggcaa gagcgacaac gtgccctccg

     4021 aagaggtcgt gaagaagatg aagaactact ggcggcagct gctgaacgcc aagctgatta

     4081 cccagagaaa gttcgacaat ctgaccaagg ccgagagagg cggcctgagc gaactggata

     4141 aggccggctt catcaagaga cagctggtgg aaacccggca gatcacaaag cacgtggcac

     4201 agatcctgga ctcccggatg aacactaagt acgacgagaa tgacaagctg atccgggaag

     4261 tgaaagtgat caccctgaag tccaagctgg tgtccgattt ccggaaggat ttccagtttt

     4321 acaaagtgcg cgagatcaac aactaccacc acgcccacga cgcctacctg aacgccgtcg

     4381 tgggaaccgc cctgatcaaa aagtacccta agctggaaag cgagttcgtg tacggcgact

     4441 acaaggtgta cgacgtgcgg aagatgatcg ccaagagcga gcaggaaatc ggcaaggcta

     4501 ccgccaagta cttcttctac agcaacatca tgaacttttt caagaccgag attaccctgg

     4561 ccaacggcga gatccggaag cggcctctga tcgagacaaa cggcgaaacc ggggagatcg

     4621 tgtgggataa gggccgggat tttgccaccg tgcggaaagt gctgagcatg ccccaagtga

     4681 atatcgtgaa aaagaccgag gtgcagacag gcggcttcag caaagagtct atcctgccca

     4741 agaggaacag cgataagctg atcgccagaa agaaggactg ggaccctaag aagtacggcg

     4801 gcttcgacag ccccaccgtg gcctattctg tgctggtggt ggccaaagtg gaaaagggca

     4861 agtccaagaa actgaagagt gtgaaagagc tgctggggat caccatcatg gaaagaagca

     4921 gcttcgagaa gaatcccatc gactttctgg aagccaaggg ctacaaagaa gtgaaaaagg

     4981 acctgatcat caagctgcct aagtactccc tgttcgagct ggaaaacggc cggaagagaa

     5041 tgctggcctc tgccggcgaa ctgcagaagg gaaacgaact ggccctgccc tccaaatatg

     5101 tgaacttcct gtacctggcc agccactatg agaagctgaa gggctccccc gaggataatg

     5161 agcagaaaca gctgtttgtg gaacagcaca agcactacct ggacgagatc atcgagcaga

     5221 tcagcgagtt ctccaagaga gtgatcctgg ccgacgctaa tctggacaaa gtgctgtccg

     5281 cctacaacaa gcaccgggat aagcccatca gagagcaggc cgagaatatc atccacctgt

     5341 ttaccctgac caatctggga gcccctgccg ccttcaagta ctttgacacc accatcgacc

     5401 ggaagaggta caccagcacc aaagaggtgc tggacgccac cctgatccac cagagcatca

     5461 ccggcctgta cgagacacgg atcgacctgt ctcagctggg aggcgacaaa aggccggcgg

     5521 ccacgaaaaa ggccggccag gcaaaaaaga aaaaggaatt cggcagtgga gagggcagag

     5581 gaagtctgct aacatgcggt gacgtcgagg agaatcctgg cccaatgacc gagtacaagc

     5641 ccacggtgcg cctcgccacc cgcgacgacg tccccagggc cgtacgcacc ctcgccgccg

     5701 cgttcgccga ctaccccgcc acgcgccaca ccgtcgatcc ggaccgccac atcgagcggg

     5761 tcaccgagct gcaagaactc ttcctcacgc gcgtcgggct cgacatcggc aaggtgtggg

     5821 tcgcggacga cggcgccgcg gtggcggtct ggaccacgcc ggagagcgtc gaagcggggg

     5881 cggtgttcgc cgagatcggc ccgcgcatgg ccgagttgag cggttcccgg ctggccgcgc

     5941 agcaacagat ggaaggcctc ctggcgccgc accggcccaa ggagcccgcg tggttcctgg

     6001 ccaccgtcgg agtctcgccc gaccaccagg gcaagggtct gggcagcgcc gtcgtgctcc

     6061 ccggagtgga ggcggccgag cgcgccgggg tgcccgcctt cctggagacc tccgcgcccc

     6121 gcaacctccc cttctacgag cggctcggct tcaccgtcac cgccgacgtc gaggtgcccg

     6181 aaggaccgcg cacctggtgc atgacccgca agcccggtgc ctgagaattc taactagagc

     6241 tcgctgatca gcctcgactg tgccttctag ttgccagcca tctgttgttt gcccctcccc

     6301 cgtgccttcc ttgaccctgg aaggtgccac tcccactgtc ctttcctaat aaaatgagga

     6361 aattgcatcg cattgtctga gtaggtgtca ttctattctg gggggtgggg tggggcagga

     6421 cagcaagggg gaggattggg aagagaatag caggcatgct ggggagcggc cgcaggaacc

     6481 cctagtgatg gagttggcca ctccctctct gcgcgctcgc tcgctcactg aggccgggcg

     6541 accaaaggtc gcccgacgcc cgggctttgc ccgggcggcc tcagtgagcg agcgagcgcg

     6601 cagctgcctg caggggcgcc tgatgcggta ttttctcctt acgcatctgt gcggtatttc

     6661 acaccgcata cgtcaaagca accatagtac gcgccctgta gcggcgcatt aagcgcggcg

     6721 ggtgtggtgg ttacgcgcag cgtgaccgct acacttgcca gcgccctagc gcccgctcct

     6781 ttcgctttct tcccttcctt tctcgccacg ttcgccggct ttccccgtca agctctaaat

     6841 cgggggctcc ctttagggtt ccgatttagt gctttacggc acctcgaccc caaaaaactt

     6901 gatttgggtg atggttcacg tagtgggcca tcgccctgat agacggtttt tcgccctttg

     6961 acgttggagt ccacgttctt taatagtgga ctcttgttcc aaactggaac aacactcaac

     7021 cctatctcgg gctattcttt tgatttataa gggattttgc cgatttcggc ctattggtta

     7081 aaaaatgagc tgatttaaca aaaatttaac gcgaatttta acaaaatatt aacgtttaca

     7141 attttatggt gcactctcag tacaatctgc tctgatgccg catagttaag ccagccccga

     7201 cacccgccaa cacccgctga cgcgccctga cgggcttgtc tgctcccggc atccgcttac

     7261 agacaagctg tgaccgtctc cgggagctgc atgtgtcaga ggttttcacc gtcatcaccg

     7321 aaacgcgcga gacgaaaggg cctcgtgata cgcctatttt tataggttaa tgtcatgata

     7381 ataatggttt cttagacgtc aggtggcact tttcggggaa atgtgcgcgg aacccctatt

     7441 tgtttatttt tctaaataca ttcaaatatg tatccgctca tgagacaata accctgataa

     7501 atgcttcaat aatattgaaa aaggaagagt atgagtattc aacatttccg tgtcgccctt

     7561 attccctttt ttgcggcatt ttgccttcct gtttttgctc acccagaaac gctggtgaaa

     7621 gtaaaagatg ctgaagatca gttgggtgca cgagtgggtt acatcgaact ggatctcaac

     7681 agcggtaaga tccttgagag tttt

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart