pYPQ203 (pMDC32- Ubi1)

$160.00

  • Model: PVT11169
  • 50 Units in Stock
Ask a question


Add to Cart:

pYPQ203 (pMDC32-Ubi1)

 

pYPQ203 (pMDC32-Ubi1) Description

pYPQ203 (pMDC32-Ubi1) is a plant cell Gateway expression plasmid.

 

pYPQ203 (pMDC32-Ubi1) Sequence

LOCUS       Exported               14174 bp ds-DNA     circular SYN 27-NOV-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..14174

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        315..991

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     CDS             1058..2083

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRSQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     polyA_signal    2124..2298

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     misc_feature    2376..2400

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             4024..4818

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     rep_origin      4905..5493

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    5679..5819

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      6163..6357

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     CDS             complement(6423..7496)

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW

                     QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS

                     KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP

                     GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE

                     ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR

                     LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI

                     LVMRYRNLIEGEASAGS"

     CDS             complement(7925..8554)

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     misc_feature    9849..9873

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        10108..12105

                     /label=Ubi promoter

                     /note="maize polyubiquitin gene promoter"

     protein_bind    12148..12272

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        12297..12327

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             12381..13061

                     /codon_start=1

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQAGRNLE

                     DPAY"

     CDS             13381..13686

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VPRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(13727..13851)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     terminator      13915..14167

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

ORIGIN

        1 cgtaatcatg tcatagctgt ttcctgtgtg aaattgttat ccgctcacaa ttccacacaa

       61 catacgagcc ggaagcataa agtgtaaagc ctggggtgcc taatgagtga gctaactcac

      121 attaattgcg ttgcgctcac tgcccgcttt ccagtcggga aacctgtcgt gccagctgca

      181 ttaatgaatc ggccaacgcg cggggagagg cggtttgcgt attggctaga gcagcttgcc

      241 aacatggtgg agcacgacac tctcgtctac tccaagaata tcaaagatac agtctcagaa

      301 gaccaaaggg ctattgagac ttttcaacaa agggtaatat cgggaaacct cctcggattc

      361 cattgcccag ctatctgtca cttcatcaaa aggacagtag aaaaggaagg tggcacctac

      421 aaatgccatc attgcgataa aggaaaggct atcgttcaag atgcctctgc cgacagtggt

      481 cccaaagatg gacccccacc cacgaggagc atcgtggaaa aagaagacgt tccaaccacg

      541 tcttcaaagc aagtggattg atgtgaacat ggtggagcac gacactctcg tctactccaa

      601 gaatatcaaa gatacagtct cagaagacca aagggctatt gagacttttc aacaaagggt

      661 aatatcggga aacctcctcg gattccattg cccagctatc tgtcacttca tcaaaaggac

      721 agtagaaaag gaaggtggca cctacaaatg ccatcattgc gataaaggaa aggctatcgt

      781 tcaagatgcc tctgccgaca gtggtcccaa agatggaccc ccacccacga ggagcatcgt

      841 ggaaaaagaa gacgttccaa ccacgtcttc aaagcaagtg gattgatgtg atatctccac

      901 tgacgtaagg gatgacgcac aatcccacta tccttcgcaa gacccttcct ctatataagg

      961 aagttcattt catttggaga ggacacgctg aaatcaccag tctctctcta caaatctatc

     1021 tctctcgagc tttcgcagat ccggggggca atgagatatg aaaaagcctg aactcaccgc

     1081 gacgtctgtc gagaagtttc tgatcgaaaa gttcgacagc gtctccgacc tgatgcagct

     1141 ctcggagggc gaagaatctc gtgctttcag cttcgatgta ggagggcgtg gatatgtcct

     1201 gcgggtaaat agctgcgccg atggtttcta caaagatcgt tatgtttatc ggcactttgc

     1261 atcggccgcg ctcccgattc cggaagtgct tgacattggg gagtttagcg agagcctgac

     1321 ctattgcatc tcccgccgtt cacagggtgt cacgttgcaa gacctgcctg aaaccgaact

     1381 gcccgctgtt ctacaaccgg tcgcggaggc tatggatgcg atcgctgcgg ccgatcttag

     1441 ccagacgagc gggttcggcc cattcggacc gcaaggaatc ggtcaataca ctacatggcg

     1501 tgatttcata tgcgcgattg ctgatcccca tgtgtatcac tggcaaactg tgatggacga

     1561 caccgtcagt gcgtccgtcg cgcaggctct cgatgagctg atgctttggg ccgaggactg

     1621 ccccgaagtc cggcacctcg tgcacgcgga tttcggctcc aacaatgtcc tgacggacaa

     1681 tggccgcata acagcggtca ttgactggag cgaggcgatg ttcggggatt cccaatacga

     1741 ggtcgccaac atcttcttct ggaggccgtg gttggcttgt atggagcagc agacgcgcta

     1801 cttcgagcgg aggcatccgg agcttgcagg atcgccacga ctccgggcgt atatgctccg

     1861 cattggtctt gaccaactct atcagagctt ggttgacggc aatttcgatg atgcagcttg

     1921 ggcgcagggt cgatgcgacg caatcgtccg atccggagcc gggactgtcg ggcgtacaca

     1981 aatcgcccgc agaagcgcgg ccgtctggac cgatggctgt gtagaagtac tcgccgatag

     2041 tggaaaccga cgccccagca ctcgtccgag ggcaaagaaa tagagtagat gccgaccggg

     2101 atctgtcgat cgacaagctc gagtttctcc ataataatgt gtgagtagtt cccagataag

     2161 ggaattaggg ttcctatagg gtttcgctca tgtgttgagc atataagaaa cccttagtat

     2221 gtatttgtat ttgtaaaata cttctatcaa taaaatttct aattcctaaa accaaaatcc

     2281 agtactaaaa tccagatccc ccgaattaat tcggcgttaa ttcagtacat taaaaacgtc

     2341 cgcaatgtgt tattaagttg tctaagcgtc aatttgttta caccacaata tatcctgcca

     2401 ccagccagcc aacagctccc cgaccggcag ctcggcacaa aatcaccact cgatacaggc

     2461 agcccatcag tccgggacgg cgtcagcggg agagccgttg taaggcggca gactttgctc

     2521 atgttaccga tgctattcgg aagaacggca actaagctgc cgggtttgaa acacggatga

     2581 tctcgcggag ggtagcatgt tgattgtaac gatgacagag cgttgctgcc tgtgatcacc

     2641 gcggtttcaa aatcggctcc gtcgatacta tgttatacgc caactttgaa aacaactttg

     2701 aaaaagctgt tttctggtat ttaaggtttt agaatgcaag gaacagtgaa ttggagttcg

     2761 tcttgttata attagggaag gtgcgaacaa gtccctgata tgagatcatg tttgtcatct

     2821 ggagccatag aacagggttc atcatgagtc atcaacttac cttcgccgac agtgaattca

     2881 gcagtaagcg ccgtcagacc agaaaagaga ttttcttgtc ccgcatggag cagattctgc

     2941 catggcaaaa catggtggaa gtcatcgagc cgttttaccc caaggctggt aatggccggc

     3001 gaccttatcc gctggaaacc atgctacgca ttcactgcat gcagcattgg tacaacctga

     3061 gcgatggcgc gatggaagat gctctgtacg aaatcgcctc catgcgtctg tttgcccggt

     3121 tatccctgga tagcgccttg ccggaccgca ccaccatcat gaatttccgc cacctgctgg

     3181 agcagcatca actggcccgc caattgttca agaccatcaa tcgctggctg gccgaagcag

     3241 gcgtcatgat gactcaaggc accttggtcg atgccaccat cattgaggca cccagctcga

     3301 ccaagaacaa agagcagcaa cgcgatccgg agatgcatca gaccaagaaa ggcaatcagt

     3361 ggcactttgg catgaaggcc cacattggtg tcgatgccaa gagtggcctg acccacagcc

     3421 tggtcaccac cgcggccaac gagcatgacc tcaatcagct gggtaatctg ctgcatggag

     3481 aggagcaatt tgtctcagcc gatgccggct accaaggggc gccacagcgc gaggagctgg

     3541 ccgaggtgga tgtggactgg ctgatcgccg agcgccccgg caaggtaaga accttgaaac

     3601 agcatccacg caagaacaaa acggccatca acatcgaata catgaaagcc agcatccggg

     3661 ccagggtgga gcacccattt cgcatcatca agcgacagtt cggcttcgtg aaagccagat

     3721 acaaggggtt gctgaaaaac gataaccaac tggcgatgtt attcacgctg gccaacctgt

     3781 ttcgggcgga ccaaatgata cgtcagtggg agagatctca ctaaaaactg gggataacgc

     3841 cttaaatggc gaagaaacgg tctaaatagg ctgattcaag gcatttacgg gagaaaaaat

     3901 cggctcaaac atgaagaaat gaaatgactg agtcagccga gaagaatttc cccgcttatt

     3961 cgcaccttcc ttagcttctt ggggtatctt taaatactgt agaaaagagg aaggaaataa

     4021 taaatggcta aaatgagaat atcaccggaa ttgaaaaaac tgatcgaaaa ataccgctgc

     4081 gtaaaagata cggaaggaat gtctcctgct aaggtatata agctggtggg agaaaatgaa

     4141 aacctatatt taaaaatgac ggacagccgg tataaaggga ccacctatga tgtggaacgg

     4201 gaaaaggaca tgatgctatg gctggaagga aagctgcctg ttccaaaggt cctgcacttt

     4261 gaacggcatg atggctggag caatctgctc atgagtgagg ccgatggcgt cctttgctcg

     4321 gaagagtatg aagatgaaca aagccctgaa aagattatcg agctgtatgc ggagtgcatc

     4381 aggctctttc actccatcga catatcggat tgtccctata cgaatagctt agacagccgc

     4441 ttagccgaat tggattactt actgaataac gatctggccg atgtggattg cgaaaactgg

     4501 gaagaagaca ctccatttaa agatccgcgc gagctgtatg attttttaaa gacggaaaag

     4561 cccgaagagg aacttgtctt ttcccacggc gacctgggag acagcaacat ctttgtgaaa

     4621 gatggcaaag taagtggctt tattgatctt gggagaagcg gcagggcgga caagtggtat

     4681 gacattgcct tctgcgtccg gtcgatcagg gaggatatcg gggaagaaca gtatgtcgag

     4741 ctattttttg acttactggg gatcaagcct gattgggaga aaataaaata ttatatttta

     4801 ctggatgaat tgttttagta cctagaatgc atgaccaaaa tcccttaacg tgagttttcg

     4861 ttccactgag cgtcagaccc cgtagaaaag atcaaaggat cttcttgaga tccttttttt

     4921 ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc taccagcggt ggtttgtttg

     4981 ccggatcaag agctaccaac tctttttccg aaggtaactg gcttcagcag agcgcagata

     5041 ccaaatactg tccttctagt gtagccgtag ttaggccacc acttcaagaa ctctgtagca

     5101 ccgcctacat acctcgctct gctaatcctg ttaccagtgg ctgctgccag tggcgataag

     5161 tcgtgtctta ccgggttgga ctcaagacga tagttaccgg ataaggcgca gcggtcgggc

     5221 tgaacggggg gttcgtgcac acagcccagc ttggagcgaa cgacctacac cgaactgaga

     5281 tacctacagc gtgagctatg agaaagcgcc acgcttcccg aagggagaaa ggcggacagg

     5341 tatccggtaa gcggcagggt cggaacagga gagcgcacga gggagcttcc agggggaaac

     5401 gcctggtatc tttatagtcc tgtcgggttt cgccacctct gacttgagcg tcgatttttg

     5461 tgatgctcgt caggggggcg gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg

     5521 ttcctggcct tttgctggcc ttttgctcac atgttctttc ctgcgttatc ccctgattct

     5581 gtggataacc gtattaccgc ctttgagtga gctgataccg ctcgccgcag ccgaacgacc

     5641 gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc tgatgcggta ttttctcctt

     5701 acgcatctgt gcggtatttc acaccgcata tggtgcactc tcagtacaat ctgctctgat

     5761 gccgcatagt taagccagta tacactccgc tatcgctacg tgactgggtc atggctgcgc

     5821 cccgacaccc gccaacaccc gctgacgcgc cctgacgggc ttgtctgctc ccggcatccg

     5881 cttacagaca agctgtgacc gtctccggga gctgcatgtg tcagaggttt tcaccgtcat

     5941 caccgaaacg cgcgaggcag ggtgccttga tgtgggcgcc ggcggtcgag tggcgacggc

     6001 gcggcttgtc cgcgccctgg tagattgcct ggccgtaggc cagccatttt tgagcggcca

     6061 gcggccgcga taggccgacg cgaagcggcg gggcgtaggg agcgcagcga ccgaagggta

     6121 ggcgcttttt gcagctcttc ggctgtgcgc tggccagaca gttatgcaca ggccaggcgg

     6181 gttttaagag ttttaataag ttttaaagag ttttaggcgg aaaaatcgcc ttttttctct

     6241 tttatatcag tcacttacat gtgtgaccgg ttcccaatgt acggctttgg gttcccaatg

     6301 tacgggttcc ggttcccaat gtacggcttt gggttcccaa tgtacgtgct atccacagga

     6361 aagagacctt ttcgaccttt ttcccctgct agggcaattt gccctagcat ctgctccgta

     6421 cattaggaac cggcggatgc ttcgccctcg atcaggttgc ggtagcgcat gactaggatc

     6481 gggccagcct gccccgcctc ctccttcaaa tcgtactccg gcaggtcatt tgacccgatc

     6541 agcttgcgca cggtgaaaca gaacttcttg aactctccgg cgctgccact gcgttcgtag

     6601 atcgtcttga acaaccatct ggcttctgcc ttgcctgcgg cgcggcgtgc caggcggtag

     6661 agaaaacggc cgatgccggg atcgatcaaa aagtaatcgg ggtgaaccgt cagcacgtcc

     6721 gggttcttgc cttctgtgat ctcgcggtac atccaatcag ctagctcgat ctcgatgtac

     6781 tccggccgcc cggtttcgct ctttacgatc ttgtagcggc taatcaaggc ttcaccctcg

     6841 gataccgtca ccaggcggcc gttcttggcc ttcttcgtac gctgcatggc aacgtgcgtg

     6901 gtgtttaacc gaatgcaggt ttctaccagg tcgtctttct gctttccgcc atcggctcgc

     6961 cggcagaact tgagtacgtc cgcaacgtgt ggacggaaca cgcggccggg cttgtctccc

     7021 ttcccttccc ggtatcggtt catggattcg gttagatggg aaaccgccat cagtaccagg

     7081 tcgtaatccc acacactggc catgccggcc ggccctgcgg aaacctctac gtgcccgtct

     7141 ggaagctcgt agcggatcac ctcgccagct cgtcggtcac gcttcgacag acggaaaacg

     7201 gccacgtcca tgatgctgcg actatcgcgg gtgcccacgt catagagcat cggaacgaaa

     7261 aaatctggtt gctcgtcgcc cttgggcggc ttcctaatcg acggcgcacc ggctgccggc

     7321 ggttgccggg attctttgcg gattcgatca gcggccgctt gccacgattc accggggcgt

     7381 gcttctgcct cgatgcgttg ccgctgggcg gcctgcgcgg ccttcaactt ctccaccagg

     7441 tcatcaccca gcgccgcgcc gatttgtacc gggccggatg gtttgcgacc gctcacgccg

     7501 attcctcggg cttgggggtt ccagtgccat tgcagggccg gcaggcaacc cagccgctta

     7561 cgcctggcca accgcccgtt cctccacaca tggggcattc cacggcgtcg gtgcctggtt

     7621 gttcttgatt ttccatgccg cctcctttag ccgctaaaat tcatctactc atttattcat

     7681 ttgctcattt actctggtag ctgcgcgatg tattcagata gcagctcggt aatggtcttg

     7741 ccttggcgta ccgcgtacat cttcagcttg gtgtgatcct ccgccggcaa ctgaaagttg

     7801 acccgcttca tggctggcgt gtctgccagg ctggccaacg ttgcagcctt gctgctgcgt

     7861 gcgctcggac ggccggcact tagcgtgttt gtgcttttgc tcattttctc tttacctcat

     7921 taactcaaat gagttttgat ttaatttcag cggccagcgc ctggacctcg cgggcagcgt

     7981 cgccctcggg ttctgattca agaacggttg tgccggcggc ggcagtgcct gggtagctca

     8041 cgcgctgcgt gatacgggac tcaagaatgg gcagctcgta cccggccagc gcctcggcaa

     8101 cctcaccgcc gatgcgcgtg cctttgatcg cccgcgacac gacaaaggcc gcttgtagcc

     8161 ttccatccgt gacctcaatg cgctgcttaa ccagctccac caggtcggcg gtggcccata

     8221 tgtcgtaagg gcttggctgc accggaatca gcacgaagtc ggctgccttg atcgcggaca

     8281 cagccaagtc cgccgcctgg ggcgctccgt cgatcactac gaagtcgcgc cggccgatgg

     8341 ccttcacgtc gcggtcaatc gtcgggcggt cgatgccgac aacggttagc ggttgatctt

     8401 cccgcacggc cgcccaatcg cgggcactgc cctggggatc ggaatcgact aacagaacat

     8461 cggccccggc gagttgcagg gcgcgggcta gatgggttgc gatggtcgtc ttgcctgacc

     8521 cgcctttctg gttaagtaca gcgataacct tcatgcgttc cccttgcgta tttgtttatt

     8581 tactcatcgc atcatatacg cagcgaccgc atgacgcaag ctgttttact caaatacaca

     8641 tcaccttttt agacggcggc gctcggtttc ttcagcggcc aagctggccg gccaggccgc

     8701 cagcttggca tcagacaaac cggccaggat ttcatgcagc cgcacggttg agacgtgcgc

     8761 gggcggctcg aacacgtacc cggccgcgat catctccgcc tcgatctctt cggtaatgaa

     8821 aaacggttcg tcctggccgt cctggtgcgg tttcatgctt gttcctcttg gcgttcattc

     8881 tcggcggccg ccagggcgtc ggcctcggtc aatgcgtcct aggcaccgcg ccgcctggcc

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart