pYX212

$260.00

  • Model: PVT11244
  • 50 Units in Stock
Ask a question


Add to Cart:

pYX212


Catalog No. PVT11244
Packing 2ug

 

PYX212 Description

 

Promoter: TPI promoter

Plasmid classification: yeast vector, Saccharomyces cerevisiae expression plasmid

Plasmid size: 8346bp

Prokaryotic resistance: ampicillin Amp

Selection marker: URA3

Clone strain: Escherichia coli DH5 alpha

Culture conditions: LB medium, 37 C

 

The pYX212 plasmid can be expressed in Saccharomyces cerevisiae, and the TPI promoter drives the expression of the target gene. The HA tag is on the C-terminal. WB test can be used to detect the expression of the gene conveniently.

 

pYX212 Multiple cloning site

pYX212-vector

 

 

pYX212 Sequence

LOCUS       Exported                8346 bp ds-DNA     circular SYN 05-JUN-2018

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pYX212

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 8346)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..8346

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    1..48

                     /note="MCS"

     CDS             49..75

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /note="HA"

                     /translation="YPYDVPDYA"

     rep_origin      394..849

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     CDS             complement(980..1783)

                     /codon_start=1

                     /gene="S. cerevisiae URA3"

                     /product="orotidine-5'-phosphate decarboxylase, required 

                     for uracil biosynthesis"

                     /note="URA3"

                     /note="yeast auxotrophic marker, counterselectable with 

                     5-fluoroorotic acid (5-FOA)"

                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL

                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ

                     YSAGVYRIAEWADITNAHGVLGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE

                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD

                     VVSTGSDIIIVGRGLFAKGRDAKVQGERYRKAGWEAYLRRCGQQN"

     promoter        complement(1784..1999)

                     /gene="S. cerevisiae URA3"

                     /note="URA3 promoter"

     rep_origin      2853..4195

                     /note="2u ori"

                     /note="yeast 2u plasmid origin of replication"

     promoter        4484..4588

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             4589..5449

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLARRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLDNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      5620..6208

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    7436..8345

                     /note="TPI promoter"

ORIGIN

        1 gaattcacca tggatcctag ggcccacaag cttacgcgtc gacccgggta tccgtatgat

       61 gtgcctgact acgcatgata tctcgagctc agctagctaa ctgaataagg aacaatgaac

      121 gtttttcctt tctcttgttc ctagtattaa tgactgaccg atacatccct tttttttttt

      181 gtctttgtct agctccagct tttgttccct ttagtgaggg ttaattcaat tcactggccg

      241 tcgttttaca acgtcgtgac tgggaaaacc ctggcgttac ccaacttaat cgccttgcag

      301 cacatccccc tttcgccagc tggcgtaata gcgaagaggc ccgcaccgat cgcccttccc

      361 aacagttgcg cagcctgaat ggcgaatggc gcgacgcgcc ctgtagcggc gcattaagcg

      421 cggcgggtgt ggtggttacg cgcagcgtga ccgctacact tgccagcgcc ctagcgcccg

      481 ctcctttcgc tttcttccct tcctttctcg ccacgttcgc cggctttccc cgtcaagctc

      541 taaatcgggg gctcccttta gggttccgat ttagtggttt acggcacctc gaccccaaaa

      601 aacttgatta gggtgatggt tcacgtagtg ggccatcgcc ctgatagacg gtttttcgcc

      661 ctttgacgtt ggagtccacg ttctttaata gtggactctt gttccaaact ggaacaacac

      721 tcaaccctat ctcggtctat tcttttgatt tataagggat tttgccgatt tcggcctatt

      781 ggttaaaaaa tgagctgatt taacaaaaat ttaacgcgaa ttttaacaaa atattaacgt

      841 ttacaatttc ctgatgcggt attttctcct tacgcatctg tgcggtattt cacaccgcat

      901 agggtaataa ctgatataat taaattgaag ctctaatttg tgagtttagt atacatgcat

      961 ttacttataa tacagttttt tagttttgct ggccgcatct tctcaaatat gcttcccagc

     1021 ctgcttttct gtaacgttca ccctgtacct tagcatccct tccctttgca aatagtcctc

     1081 ttccaacaat aataatgtca gatcctgtag agaccacatc atccacggtt ctatactgtt

     1141 gacccaatgc gtctcccttg tcatctaaac ccacaccggg tgtcataatc aaccaatcgt

     1201 aaccttcatc tcttccaccc atgtctcttt gagcaataaa gccgataaca aaatctttgt

     1261 cgctcttcgc aatgtcaaca gtacccttag tatattctcc agtagatagg gagcccttgc

     1321 atgacaattc tgctaacatc aaaaggcctc taggttcctt tgttacttct tctgccgcct

     1381 gcttcaaacc gctaacaata cctggcccca gcacaccgtg tgcattcgta atgtctgccc

     1441 attctgctat tctgtataca cccgcagagt actgcaattt gactgtatta ccaatgtcag

     1501 caaattttct gtcttcgaag agtaaaaaat tgtacttggc ggataatgcc tttagcggct

     1561 taactgtgcc ctccatcgaa aaatcagtca atatatccac atgtgttttt agtaaacaaa

     1621 ttttgggacc taatgcttca actaactcca gtaattcctt ggtggtacga acatccaatg

     1681 aagcacacaa gtttgtttgc ttttcgtgca tgatattaaa tagcttggca gcaacaggac

     1741 taggatgagt agcagcacgt tccttatatg tagctttcga catgatttat cttcgtttcc

     1801 tgcaggtttt tgttctgtgc agttgggtta agaatactgg gcaatttcat gtttcttcaa

     1861 cactacatat gcgtatatat accaatctaa gtctgtgctc cttccttcgt tcttccttct

     1921 gttcggagat taccgaatca aaaaaatttc aaagaaaccg aaatcaaaaa aaagaataaa

     1981 aaaaaaatga tgaattgaat tgaaaagctg tggtatggtg cactctcagt acaatctgct

     2041 ctgatgccgc atagttaagc cagccccgac acccgccaac acccgctgac gcgccctgac

     2101 gggcttgtct gctcccggca tccgcttaca gacaagctgt gaccgtctcc gggagctgca

     2161 tgtgtcagag gttttcaccg tcatcaccga aacgcgcgag acgaaagggc ctcgtgatac

     2221 gcctattttt ataggttaat gtcatgataa taatggtttc ttagacgtgc ggccgctcta

     2281 gaactagtgg atcaattcca cggactatag actatactag tatactccgt ctactgtacg

     2341 atacacttcc gctcaggtcc ttgtccttta acgaggcctt accactcttt tgttactcta

     2401 ttgatccagc tcagcaaagg cagtgtgatc taagattcta tcttcgcgat gtagtaaaac

     2461 tagctagacc gagaaagaga ctagaaatgc aaaaggcact tctacaatgg ctgccatcat

     2521 tattatccga tgtgacgctg cagcttctca atgatattcg aatacgcttt gaggagatac

     2581 agcctaatat ccgacaaact gttttacaga tttacgatcg tacttgttac ccatcattga

     2641 attttgaaca tccgaacctg ggagttttcc ctgaaacaga tagtatattt gaacctgtat

     2701 aataatatat agtctagcgc tttacggaag acaatgtatg tatttcggtt cctggagaaa

     2761 ctattgcatc tattgcatag gtaatcttgc acgtcgcatc cccggttcat tttctgcgtt

     2821 tccatcttgc acttcaatag catatctttg ttaacgaagc atctgtgctt cattttgtag

     2881 aacaaaaatg caacgcgaga gcgctaattt ttcaaacaaa gaatctgagc tgcattttta

     2941 cagaacagaa atgcaacgcg aaagcgctat tttaccaacg aagaatctgt gcttcatttt

     3001 tgtaaaacaa aaatgcaacg cgagagcgct aatttttcaa acaaagaatc tgagctgcat

     3061 ttttacagaa cagaaatgca acgcgagagc gctattttac caacaaagaa tctatacttc

     3121 ttttttgttc tacaaaaatg catcccgaga gcgctatttt tctaacaaag catcttagat

     3181 tacttttttt ctcctttgtg cgctctataa tgcagtctct tgataacttt ttgcactgta

     3241 ggtccgttaa ggttagaaga aggctacttt ggtgtctatt ttctcttcca taaaaaaagc

     3301 ctgactccac ttcccgcgtt tactgattac tagcgaagct gcgggtgcat tttttcaaga

     3361 taaaggcatc cccgattata ttctataccg atgtggattc cgcatacttt gtgaacagaa

     3421 agtgatagcg ttgatgattc ttcattggtc agaaaattat gaacggtttc ttctattttg

     3481 tctctatata ctacgtatag gaaatgttta cattttcgta ttgttttcga ttcactctat

     3541 gaatagttct tactacaatt tttttgtcta aagagtaata ctagagataa acataaaaaa

     3601 tgtagaggtc gagtttagat gcaagttcaa ggagcgaaag gtggatgggt aggttatata

     3661 gggatatagc acagagatat atagcaaaga gatacttttc agcaatgttt gtggaagcgg

     3721 tattcgcaat attttagtag ctcgttacag tccggtgcgt ttttggtttt ttgaaagtgc

     3781 gtcttcagag cgcttttggt tttcaaaagc gctctgaagt tcctatactt tctagagaat

     3841 aggaacttcg gaataggaac ttcaaagcgt ttccgaaaac gagcgcttcc gaaaatgcaa

     3901 cgcgagctgc gcacatacag ctcactgttc acgtcgcacc tatatctgcg tgttgcctgt

     3961 atatatatat acatgagaag aacggcatag tgcgtgttta tgcttaaatg cgtacttata

     4021 tgcgtctatt tatgtaggat gaaaggtagt ctagtacctc ctgtgatatt atcccattcc

     4081 atgcggggta tcgtatgctt ccttcagcac taccctttag ctgttctata tgctgccact

     4141 cctcaattgg attagtctca tccttcaatg ctatcatttc ctttgatatt ggatcatatg

     4201 catagtaccg agaaactagt gcgaagtagt gatcaggtat tgctgttatc tgatgagtat

     4261 acgttgtcct ggccacggca gaagcaccct tatcgctcca atttcccaca acattagtca

     4321 actccgttag gcccttcatt gaaagaaatg aggtcatcaa atgtcttcca atgtgagatt

     4381 ttgggccatt ttttatagca aagattgaat aaggcgcatt tttcttcaaa gctgcggccg

     4441 cactctcact agtacgtcag gtggcacttt tcggggaaat gtgcgcggaa cccctatttg

     4501 tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac cgtgataaat

     4561 gcttcaataa tattgaaaaa ggaagagtat gagtattcaa catttccgtg tcgcccttat

     4621 tccctttttt gcggcatttt gccttcctgt ttttgctcac ccagaaacgc tggtgaaagt

     4681 aaaagatgct gaagatcagt tgggtgcacg agtgggttac atcgaactgg atctcaacag

     4741 cggtaagatc cttgagagtt ttcgccccga agaacgtttt ccaatgatga gcacttttaa

     4801 agttctgcta tgtggcgcgg tattatcccg tattgacgcc gggcaagagc aactcgctcg

     4861 ccgcatacac tattctcaga atgacttggt tgagtactca ccagtcacag aaaagcatct

     4921 tacggatggc atgacagtaa gagaattatg cagtgctgcc ataaccatga gtgataacac

     4981 tgcggccaac ttacttctga caacgatcgg aggaccgaag gagctaaccg cttttttgga

     5041 caacatgggg gatcatgtaa ctcgccttga tcgttgggaa ccggagctga atgaagccat

     5101 accaaacgac gagcgtgaca ccacgatgcc tgtagcaatg gcaacaacgt tgcgcaaact

     5161 attaactggc gaactactta ctctagcttc ccggcaacaa ttaatagact ggatggaggc

     5221 ggataaagtt gcaggaccac ttctgcgctc ggcccttccg gctggctggt ttattgctga

     5281 taaatctgga gccggtgagc gtgggtctcg cggtatcatt gcagcactgg ggccagatgg

     5341 taagccctcc cgtatcgtag ttatctacac gacggggagt caggcaacta tggatgaacg

     5401 aaatagacag atcgctgaga taggtgcctc actgattaag cattggtaac tgtcagacca

     5461 agtttactca tatatacttt agattgattt aaaacttcat ttttaattta aaaggatcta

     5521 ggtgaagatc ctttttgata atctcatgac caaaatccct taacgtgagt tttcgttcca

     5581 ctgagcgtca gaccccgtag aaaagatcaa aggatcttct tgagatcctt tttttctgcg

     5641 cgtaatctgc tgcttgcaaa caaaaaaacc accgctacca gcggtggttt gtttgccgga

     5701 tcaagagcta ccaactcttt ttccgaaggt aactggcttc agcagagcgc agataccaaa

     5761 tactgtcctt ctagtgtagc cgtagttagg ccaccacttc aagaactctg tagcaccgcc

     5821 tacatacctc gctctgctaa tcctgttacc agtggctgct gccagtggcg ataagtcgtg

     5881 tcttaccggg ttggactcaa gacgatagtt accggataag gcgcagcggt cgggctgaac

     5941 ggggggttcg tgcacacagc ccagcttgga gcgaacgacc tacaccgaac tgagatacct

     6001 acagcgtgag ctatgagaaa gcgccacgct tcccgaaggg agaaaggcgg acaggtatcc

     6061 ggtaagcggc agggtcggaa caggagagcg cacgagggag cttccagggg gaaacgcctg

     6121 gtatctttat agtcctgtcg ggtttcgcca cctctgactt gagcgtcgat ttttgtgatg

     6181 ctcgtcaggg gggcggagcc tatggaaaaa cgccagcaac gcggcctttt tacggttcct

     6241 ggccttttgc tggccttttg ctcacatgtt ctttcctgcg ttatcccctg attctgtgga

     6301 taaccgtatt accgcctttg agtgagctga taccggtcgc cgcagccgaa cgaccgagcg

     6361 cagcgagtca gtgagcgagg aagcggaaga gcgcccaata cgcaaaccgc ctctccccgc

     6421 gcgttggccg attcattaat gcagctggca cgacaggttt cccgactgga aagcgggcag

     6481 tgagcgcaac gcaattaatg tgagttacct cactcattag gcaccccagg ctttacactt

     6541 tatgcttccg gctcctatgt tgtgtggaat tgtgagcgga taacaatttc acacaggaaa

     6601 cagctatgac catgattacg ccaagctcga aatacgactc actatagggc gaattgggta

     6661 ccgggccggc cgtcgagctt gatggcatcg tggtgtcacg ctcgtcgttt ggtatggctt

     6721 cattcagctc cggttcccaa cgatcaaggc gagttacatg atcccccatg ttgtgaaaaa

     6781 aagcggttag ctcttcggtc ctccgatcgt tgtcagaagt aagttggccg cagtgttatc

     6841 actcatggtt atggcaggaa ctgcataatt ctcttactgt catgccatcc gtaagatgct

     6901 tttctgtgac tggtgtactc aaccaagtca ttctgagaat agtgtatgcg gcgaccgagt

     6961 tgctcttgcc cggcgtcaac acgggataat accgcgccac atagcagaac tttaaaagtg

     7021 ctcatcattg gaaaacgttc ttcggggcga aaactctcaa ggatcttacc gctgttgaga

     7081 tccagttcga tgtaacccac tcgtgcaccc aactgatctt cagcatcttt tactttcacc

     7141 agcgtttctg ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg aataagggcg

     7201 acacggaaat gttgaatact catactcttc ctttttcaat attattgaag catttatcag

     7261 ggttattgtc tcatgagcga tacatatttg aatgtattta gaaaaataaa caaatagggg

     7321 ttccgcgcac atttccccga aaagtgccac ctgacgtcta agaaaccatt attatcatga

     7381 cattaaccta taaaaatagg cgtatcacga ggccctttcg tcttcaagaa ttggggatct

     7441 acgtatggtc attcttcttc agattccctc atggagaagt gcggcagatg tatatgacag

     7501 agtcgccagt ttccaagaga ctttattcag gcacttccat gataggcaag agagaagacc

     7561 cagagatgtt gttgtcctag ttacacatgg tatttattcc agagtattcc tgatgaaatg

     7621 gtttagatgg acatacgaag agtttgaatc gtttaccaat gttcctaacg ggagcgtaat

     7681 ggtgatggaa ctggacgaat ccatcaatag atacgtcctg aggaccgtgc tacccaaatg

     7741 gactgattgt gagggagacc taactacata gtgtttaaag attacggata tttaacttac

     7801 ttagaataat gccatttttt tgagttataa taatcctacg ttagtgtgag cgggatttaa

     7861 actgtgagga cctcaataca ttcagacact tctgacggta tcaccctact tattcccttc

     7921 gagattatat ctaggaaccc atcaggttgg tggaagatta cccgttctaa gacttttcag

     7981 cttcctctat tgatgttaca ctcggacacc ccttttctgg catccagttt ttaatcttca

     8041 gtggcatgtg agattctccg aaattaatta aagcaatcac acaattctct cggataccac

     8101 ctcggttgaa actgacaggt ggtttgttac gcatgctaat gcaaaggagc ctatatacct

     8161 ttggctcggc tgctgtaaca gggaatataa agggcagcat aatttaggag tttagtgaac

     8221 ttgcaacatt tactattttc ccttcttacg taaatatttt tctttttaat tctaaatcaa

     8281 tctttttcaa ttttttgttt gtattctttt cttgcttaaa tctataacta caaaaaacac

     8341 atacag

//

 


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart