SaBE4- Gam

$160.00

  • Model: PVT10485
  • 50 Units in Stock
Ask a question


Add to Cart:

SaBE4-Gam

Catalog No. PVT10485
Packing 2ug

 

SaBE4-Gam Information
Function ORF expression plasmid

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli Stbl3

Culture conditions: 37 degrees centigrade

 

SaBE4-Gam Description

SaBE4-Gam is an overexpression plasmid of rat mammalian genes.

 

SaBE4-Gam Sequence

LOCUS       Exported                8601 bp ds-DNA     circular SYN 01-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..8601

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        132..335

                     /label=CMV promoter

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     promoter        377..395

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     regulatory      403..412

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     misc_feature    409..930

                     /label=Gam

     CDS             979..1662

                     /codon_start=1

                     /product="cytidine deaminase (C to U editing enzyme) from 

                     rat"

                     /label=APOBEC-1

                     /note="can use ssDNA as a substrate (Komor et al., 2016)"

                     /translation="SSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGG

                     RHSIWRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLS

                     RYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNE

                     AHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHIL

                     WATGLK"

     misc_feature    1759..4917

                     /label=SaCas9

     CDS             4924..4944

                     /codon_start=1

                     /product="nuclear localization signal of SV40 (simian virus

                     40) large T antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     CDS             4951..5016

                     /codon_start=1

                     /product="three tandem FLAG(R) epitope tags, followed by an

                     enterokinase cleavage site"

                     /label=3xFLAG

                     /translation="DYKDHDGDYKDHDIDYKDDDDK"

     CDS             5047..5295

                     /codon_start=1

                     /product="uracil-DNA glycosylase inhibitor from a Bacillus 

                     subtilis bacteriophage (Mol et al., 1995)"

                     /label=UGI

                     /translation="TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTA

                     YDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML"

     CDS             5326..5574

                     /codon_start=1

                     /product="uracil-DNA glycosylase inhibitor from a Bacillus 

                     subtilis bacteriophage (Mol et al., 1995)"

                     /label=UGI

                     /translation="TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTA

                     YDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML"

     CDS             5587..5607

                     /codon_start=1

                     /product="nuclear localization signal of SV40 (simian virus

                     40) large T antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     CDS             5616..5633

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     polyA_signal    5662..5886

                     /label=bGH poly(A) signal

                     /note="bovine growth hormone polyadenylation signal"

     rep_origin      complement(6359..6947)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7118..7978)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(7979..8083)

                     /gene="bla"

                     /label=AmpR promoter

     enhancer        8353..131

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer"

ORIGIN

        1 atatgccaag tacgccccct attgacgtca atgacggtaa atggcccgcc tggcattatg

       61 cccagtacat gaccttatgg gactttccta cttggcagta catctacgta ttagtcatcg

      121 ctattaccat ggtgatgcgg ttttggcagt acatcaatgg gcgtggatag cggtttgact

      181 cacggggatt tccaagtctc caccccattg acgtcaatgg gagtttgttt tggcaccaaa

      241 atcaacggga ctttccaaaa tgtcgtaaca actccgcccc attgacgcaa atgggcggta

      301 ggcgtgtacg gtgggaggtc tatataagca gagctggttt agtgaaccgt cagatccgct

      361 agagatccgc ggccgctaat acgactcact atagggagag ccgccaccat ggctaaacca

      421 gcaaaacgta tcaagagtgc cgcagcggct tatgtgccac aaaaccgcga tgcggtgatt

      481 accgatatta aacgcatcgg ggatttacag cgcgaagcat cacgtctgga aacggaaatg

      541 aatgatgcca tcgcggaaat tacggagaaa tttgcggccc ggattgcacc gattaaaacc

      601 gatattgaaa ccctttcaaa aggcgttcag ggatggtgtg aagcgaaccg cgacgaactg

      661 acgaacggcg gcaaagtgaa gacggcgaat cttgtcaccg gtgatgtatc gtggcgggtc

      721 cgtccaccat cagtaagtat tcgtggtatg gatgcagtga tggaaacgct ggagcgtctt

      781 ggcctgcaac gctttattcg cacgaagcag gaaatcaaca aggaagcgat tttactggaa

      841 ccgaaagcgg tcgcaggcgt tgccggaatt acagttaaat caggcattga ggatttttct

      901 attattccat ttgaacagga agccggtatt agcggcagcg agactcccgg gacctcagag

      961 tccgctacac ccgaaagtag ctcagagact ggcccagtgg ctgtggaccc cacattgaga

     1021 cggcggatcg agccccatga gtttgaggta ttcttcgatc cgagagagct ccgcaaggag

     1081 acctgcctgc tttacgaaat taattggggg ggccggcact ccatttggcg acatacatca

     1141 cagaacacta acaagcacgt cgaagtcaac ttcatcgaga agttcacgac agaaagatat

     1201 ttctgtccga acacaaggtg cagcattacc tggtttctca gctggagccc atgcggcgaa

     1261 tgtagtaggg ccatcactga attcctgtca aggtatcccc acgtcactct gtttatttac

     1321 atcgcaaggc tgtaccacca cgctgacccc cgcaatcgac aaggcctgcg ggatttgatc

     1381 tcttcaggtg tgactatcca aattatgact gagcaggagt caggatactg ctggagaaac

     1441 tttgtgaatt atagcccgag taatgaagcc cactggccta ggtatcccca tctgtgggta

     1501 cgactgtacg ttcttgaact gtactgcatc atactgggcc tgcctccttg tctcaacatt

     1561 ctgagaagga agcagccaca gctgacattc tttaccatcg ctcttcagtc ttgtcattac

     1621 cagcgactgc ccccacacat tctctgggcc accgggttga aatctggtgg ttcttctggt

     1681 ggttctagcg gcagcgagac tcccgggacc tcagagtccg ccacacccga aagttctggt

     1741 ggttcttctg gtggttctgg gaaacggaac tacatcctgg ggcttgccat tgggataacc

     1801 agcgttggct acggaattat tgattatgag acacgcgatg tgattgacgc cggggttagg

     1861 ctgttcaaag aggccaacgt tgaaaacaac gagggaagac ggagtaagcg cggagcaaga

     1921 agactcaagc gcagacggag acatcggatt cagagggtga aaaagctgct cttcgattac

     1981 aatctcctga ccgatcatag tgagctgagc ggaatcaacc cctacgaggc gcgagtgaaa

     2041 gggctttccc agaagctgtc cgaagaggag ttctccgccg cgttgctgca cctggccaaa

     2101 cggagggggg ttcacaatgt aaacgaagtg gaggaggaca cgggcaatga acttagtacg

     2161 aaagaacaga tcagtaggaa ctctaaggct ctcgaagaga aatacgtcgc tgagttgcag

     2221 cttgagagac tgaaaaaaga cggcgaagta cgcggatcta ttaataggtt caagacttca

     2281 gattacgtaa aggaagccaa gcagctcctg aaagtacaga aagcgtacca tcagctcgat

     2341 cagagcttca tcgataccta catagatttg ctggagacac ggaggacata ctacgagggc

     2401 ccaggggaag gatctccttt tgggtggaag gacatcaagg aatggtacga gatgcttatg

     2461 ggacattgta catattttcc ggaggagctc aggagcgtca agtacgccta caatgccgac

     2521 ctgtacaatg ccctcaatga cctcaataac ctcgtgatta ccagggacga gaacgagaag

     2581 ctggagtact atgaaaagtt ccagattatc gagaatgtgt ttaagcagaa gaagaagccg

     2641 acacttaagc agattgcaaa ggaaatcctc gtgaatgagg aagatatcaa gggatacaga

     2701 gtgacaagta caggcaagcc cgagttcaca aatctgaagg tgtaccacga tattaaggac

     2761 ataaccgcac gaaaggagat aatcgaaaac gctgagctcc tcgatcagat cgcaaaaatt

     2821 cttaccatct accagtctag tgaggacatt caggaggaac tgactaatct gaacagtgag

     2881 ctcacccaag aggaaattga gcagatttca aacctgaaag gctacaccgg gacgcacaat

     2941 ctgagcctca aagcaatcaa cctcattctg gatgaacttt ggcacacaaa tgacaaccaa

     3001 attgccatat tcaaccgcct gaaactggtg ccaaaaaaag tggatctgtc acagcaaaag

     3061 gaaatcccta caaccttggt tgacgatttt attctgtccc ccgttgtcaa gcggagcttc

     3121 atccagtcaa tcaaggtgat caatgccatc attaaaaaat acggattgcc aaacgatata

     3181 attatcgagc ttgcacgaga gaagaactca aaggacgccc agaagatgat taacgaaatg

     3241 cagaagcgca accgccagac aaacgaacgc atagaggaaa ttataagaac aaccggcaaa

     3301 gagaatgcca agtatctgat cgagaaaatc aagctgcacg acatgcaaga aggcaagtgc

     3361 ctgtactctc tggaagctat cccactcgaa gatctgctga ataatccatt caattacgag

     3421 gtggaccaca tcatccctag atccgtaagc tttgacaatt ccttcaataa caaagttctg

     3481 gttaaacagg aggaaaattc taaaaaaggg aaccggaccc cgttccagta cctgagctcc

     3541 agtgacagca agattagcta cgagactttt aagaaacata ttctgaatct ggccaaaggc

     3601 aaaggcagga tcagcaagac caagaaggag tacctcctcg aagaacgcga cattaacaga

     3661 tttagtgtgc agaaagattt catcaaccga aaccttgtcg atactcggta cgccacgaga

     3721 ggcctgatga atctcctcag gagctacttc cgcgtcaata atctggacgt taaagtcaag

     3781 agcataaatg ggggattcac cagctttctg aggagaaagt ggaagtttaa gaaggaacga

     3841 aacaaaggat acaagcacca tgctgaggat gctttgatca tcgctaacgc ggactttatc

     3901 tttaaggaat ggaaaaagct ggataaggca aagaaagtga tggaaaacca gatgttcgag

     3961 gagaagcagg cagagtcaat gcctgagatc gagacagagc aggaatacaa ggaaattttc

     4021 atcacccctc atcagattaa acacataaag gacttcaaag actataaata ctctcatagg

     4081 gtggacaaaa aacccaatcg cgagctcatt aatgacaccc tgtactcaac acggaaggat

     4141 gataaaggta ataccttgat tgtgaataat cttaatggat tgtatgacaa agataacgac

     4201 aagctcaaga agctgatcaa caagtctcca gagaagctcc ttatgtatca ccacgaccca

     4261 cagacttatc agaaattgaa actgatcatg gagcaatacg gggatgagaa gaacccactc

     4321 tacaaatatt atgaggaaac aggtaattac ctgaccaagt actccaagaa ggataacgga

     4381 ccagtgatca aaaagataaa gtactatggc aacaaactta atgcgcattt ggacataact

     4441 gacgattacc ccaattctcg aaacaaggtt gtgaagctct ccctgaagcc ttatagattt

     4501 gacgtgtacc tggataatgg ggtttataaa ttcgtcaccg tgaaaaatct ggacgtgatc

     4561 aaaaaggaga actattatga agtaaactca aagtgctatg aggaggcgaa gaagctgaag

     4621 aagatctcca atcaggccga gttcatcgct tccttctata ataacgatct catcaagatc

     4681 aatggagagc tttatcgcgt cattggtgtg aacaatgact tgctgaacag gatcgaagtc

     4741 aatatgatag acattaccta ccgggagtat ctcgaaaaca tgaatgataa acggccgcct

     4801 cgcatcatca agacaatcgc atctaaaact cagtcaataa aaaagtactc taccgatatc

     4861 ctggggaatc tctatgaagt gaagtcaaag aagcacccac aaatcattaa aaaaggtgga

     4921 tcccccaaga agaagaggaa agtctcgagc gactacaaag accatgacgg tgattataaa

     4981 gatcatgaca tcgattacaa ggatgacgat gacaagtctg gtggttctgg aggatctggt

     5041 ggttctacta atctgtcaga tattattgaa aaggagaccg gtaagcaact ggttatccag

     5101 gaatccatcc tcatgctccc agaggaggtg gaagaagtca ttgggaacaa gccggaaagc

     5161 gatatactcg tgcacaccgc ctacgacgag agcaccgacg agaatgtcat gcttctgact

     5221 agcgacgccc ctgaatacaa gccttgggct ctggtcatac aggatagcaa cggtgagaac

     5281 aagattaaga tgctctctgg tggttctgga ggatctggtg gttctactaa tctgtcagat

     5341 attattgaaa aggagaccgg taagcaactg gttatccagg aatccatcct catgctccca

     5401 gaggaggtgg aagaagtcat tgggaacaag ccggaaagcg atatactcgt gcacaccgcc

     5461 tacgacgaga gcaccgacga gaatgtcatg cttctgacta gcgacgcccc tgaatacaag

     5521 ccttgggctc tggtcataca ggatagcaac ggtgagaaca agattaagat gctctctggt

     5581 ggttctccca agaagaagag gaaagtctaa ccggtcatca tcaccatcac cattgagttt

     5641 aaacccgctg atcagcctcg actgtgcctt ctagttgcca gccatctgtt gtttgcccct

     5701 cccccgtgcc ttccttgacc ctggaaggtg ccactcccac tgtcctttcc taataaaatg

     5761 aggaaattgc atcgcattgt ctgagtaggt gtcattctat tctggggggt ggggtggggc

     5821 aggacagcaa gggggaggat tgggaagaca atagcaggca tgctggggat gcggtgggct

     5881 ctatggcttc tgaggcggaa agaaccagct ggggctcgat accgtcgacc tctagctaga

     5941 gcttggcgta atcatggtca tagctgtttc ctgtgtgaaa ttgttatccg ctcacaattc

     6001 cacacaacat acgagccgga agcataaagt gtaaagccta gggtgcctaa tgagtgagct

     6061 aactcacatt aattgcgttg cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc

     6121 agctgcatta atgaatcggc caacgcgcgg ggagaggcgg tttgcgtatt gggcgctctt

     6181 ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag

     6241 ctcactcaaa ggcggtaata cggttatcca cagaatcagg ggataacgca ggaaagaaca

     6301 tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt

     6361 tccataggct ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc

     6421 gaaacccgac aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct

     6481 ctcctgttcc gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg

     6541 tggcgctttc tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca

     6601 agctgggctg tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact

     6661 atcgtcttga gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta

     6721 acaggattag cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta

     6781 actacggcta cactagaaga acagtatttg gtatctgcgc tctgctgaag ccagttacct

     6841 tcggaaaaag agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt

     6901 tttttgtttg caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga

     6961 tcttttctac ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca

     7021 tgagattatc aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat

     7081 caatctaaag tatatatgag taaacttggt ctgacagtta ccaatgctta atcagtgagg

     7141 cacctatctc agcgatctgt ctatttcgtt catccatagt tgcctgactc cccgtcgtgt

     7201 agataactac gatacgggag ggcttaccat ctggccccag tgctgcaatg ataccgcgag

     7261 acccacgctc accggctcca gatttatcag caataaacca gccagccgga agggccgagc

     7321 gcagaagtgg tcctgcaact ttatccgcct ccatccagtc tattaattgt tgccgggaag

     7381 ctagagtaag tagttcgcca gttaatagtt tgcgcaacgt tgttgccatt gctacaggca

     7441 tcgtggtgtc acgctcgtcg tttggtatgg cttcattcag ctccggttcc caacgatcaa

     7501 ggcgagttac atgatccccc atgttgtgca aaaaagcggt tagctccttc ggtcctccga

     7561 tcgttgtcag aagtaagttg gccgcagtgt tatcactcat ggttatggca gcactgcata

     7621 attctcttac tgtcatgcca tccgtaagat gcttttctgt gactggtgag tactcaacca

     7681 agtcattctg agaatagtgt atgcggcgac cgagttgctc ttgcccggcg tcaatacggg

     7741 ataataccgc gccacatagc agaactttaa aagtgctcat cattggaaaa cgttcttcgg

     7801 ggcgaaaact ctcaaggatc ttaccgctgt tgagatccag ttcgatgtaa cccactcgtg

     7861 cacccaactg atcttcagca tcttttactt tcaccagcgt ttctgggtga gcaaaaacag

     7921 gaaggcaaaa tgccgcaaaa aagggaataa gggcgacacg gaaatgttga atactcatac

     7981 tcttcctttt tcaatattat tgaagcattt atcagggtta ttgtctcatg agcggataca

     8041 tatttgaatg tatttagaaa aataaacaaa taggggttcc gcgcacattt ccccgaaaag

     8101 tgccacctga cgtcgacgga tcgggagatc gatctcccga tcccctaggg tcgactctca

     8161 gtacaatctg ctctgatgcc gcatagttaa gccagtatct gctccctgct tgtgtgttgg

     8221 aggtcgctga gtagtgcgcg agcaaaattt aagctacaac aaggcaaggc ttgaccgaca

     8281 attgcatgaa gaatctgctt agggttaggc gttttgcgct gcttcgcgat gtacgggcca

     8341 gatatacgcg ttgacattga ttattgacta gttattaata gtaatcaatt acggggtcat

     8401 tagttcatag cccatatatg gagttccgcg ttacataact tacggtaaat ggcccgcctg

     8461 gctgaccgcc caacgacccc cgcccattga cgtcaataat gacgtatgtt cccatagtaa

     8521 cgccaatagg gactttccat tgacgtcaat gggtggagta tttacggtaa actgcccact

     8581 tggcagtaca tcaagtgtat c

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart