Super PiggyBac Transposase (PB200PA- 1) Plasmid

$216.00

  • Model: PVT1602
  • 49 Units in Stock
Ask a question


Add to Cart:

Super PiggyBac Transposase (PB200PA-1)

 

Search name

Super PiggyBac Transposase (PB200PA-1) ,Plasmid Super PiggyBac Transposase (PB200PA-1) ,Super PiggyBac Transposase (PB200PA-1) vector

 

Super PiggyBac Transposase (PB200PA-1) Informaiton

Promoter: T3, T7

Replicator: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid classification: mammalian cells, transposon carriers

Plasmid size: 8531bp

Prokaryotic resistance: Amp

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: primers designed according to sequence

 

Super PiggyBac Transposase (PB200PA-1) Description

The PiggyBac (PB) transposon is a mobile genetic element that efficiently transposes between vectors andchromosomes via a "cut and paste" mechanism. During transposition, the PB transposase recognizes transposonspecific inverted terminal repeat sequences (ITRs) located on both ends of the transposon vector and efficiently moves the contents from the original sites and efficiently integrates them into TTAA chromosomal sites. The powerful activity of the piggyBac transposon system enables genes of interest between the two ITRs in the PB vector to be easily mobilized into target genomes.The Super PiggyBac transposase expression vector features a 5’ HS4 insulator to support robust transcription from the rPolr2A promoter. The PiggyBac transposase coding sequence has been optimized for high expression, stability and activity in mammalian cells.

Super-PiggyBac-Transposase-PB200PA- 1-Plasmid-polyclonal-site

 

Super PiggyBac Transposase (PB200PA-1) Sequence

 

LOCUS       Exported                8531 bp ds-DNA     circular SYN 17-AUG-2018

DEFINITION  synthetic circular DNA

KEYWORDS    Super PiggyBac Transposase(PB200PA-1)

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 8531)

  TITLE     Direct Submission

  JOURNAL   Exported Friday, August 17, 2018 from SnapGene 3.2.1

FEATURES             Location/Qualifiers

     source          1..8531

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     intron          3442..3538

                     /note="SV40 intron"

                     /note="modified SV40 intron with splice donor and acceptor 

                     sites"

     regulatory      3608..3617

                     /regulatory_class="other"

                     /note="Kozak sequence"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             3614..5398

                     /codon_start=1

                     /note="Super PiggyBac Transposase"

                     /translation="MGSSLDDEHILSALLQSDDELVGEDSDSEVSDHVSEDDVQSDTEE

                     AFIDEVHEVQPTSSGSEILDEQNVIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKST

                     RRSRVSALNIVRSQRGPTRMCRNIYDPLLCFKLFFTDEIISEIVKWTNAEISLKRRESM

                     TSATFRDTNEDEIYAFFGILVMTAVRKDNHMSTDDLFDRSLSMVYVSVMSRDRFDFLIR

                     CLRMDDKSIRPTLRENDVFTPVRKIWDLFIHQCIQNYTPGAHLTIDEQLLGFRGRCPFR

                     VYIPNKPSKYGIKILMMCDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVHGSC

                     RNITCDNWFTSIPLAKNLLQEPYKLTIVGTVRSNKREIPEVLKNSRSRPVGTSMFCFDG

                     PLTLVSYKPKPAKMVYLLSSCDEDASINESTGKPQMVMYYNQTKGGVDTLDQMCSVMTC

                     SRKTNRWPMALLYGMINIACINSFIIYSHNVSSKGEKVQSRKKFMRNLYMSLTSSFMRK

                     RLEAPTLKRYLRDNISNILPKEVPGTSDDSTEEPVMKKRTYCTYCPSKIRRKANASCKK

                     CKKVICREHNIDMCQSCF"

     polyA_signal    5424..5558

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(6116..6704)

                     /direction=LEFT

                     /note="pUC ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6875..7735)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(7736..7840)

                     /gene="bla"

                     /note="AmpR promoter"

     rep_origin      7867..8322

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

ORIGIN

        1 gcggccgcga gctcacgggg acagcccccc cccaaagccc ccagggatgt aattacgtcc

       61 ctcccccgct agggggcagc agcgagccgc ccggggctcc gctccggtcc ggcgctcccc

      121 ccgcatcccc gagccggcag cgtgcgggga cagcccgggc acggggaagg tggcacggga

      181 tcgctttcct ctgaacgctt ctcgctgctc tttgagcctg cagacacctg gggggatacg

      241 gggaaaaagc tttaggctga aagagagatt tagaatgaca gaatcataga acggcctggg

      301 ttgcaaagga gcacagtgct catccagatc caaccccctg ctatgtgcag ggtcatcaac

      361 cagcagccca ggctgcccag agccacatcc agcctggcct tgaatgcctg cagggatggg

      421 gcatccacag cctccttggg caacctgttc agtgcgtcac caccctctgg gggaaaaact

      481 gcctcctcat atccaaccca aacctcccct gtctcagtgt aaagccattc ccccttgtcc

      541 tatcaagggg gagtttgctg tgacattgtt ggtctggggt gacacatgtt tgccaattca

      601 gtgcatcacg gagaggcaga tcttggggat aaggaagtgc aggacagcat ggacgtggga

      661 catgcaggtg ttgagggctc tgggacactc tccaagtcac agcgttcaga acagccttaa

      721 ggataagaag ataggataga aggacaaaga gcaagttaaa acccagcatg gagaggagca

      781 caaaaaggcc acagacactg ctggtccctg tgtctgagcc tgcatgtttg atggtgtctg

      841 gatgcaagca gaaggggtgg aagagcttgc ctggagagat acagctgggt cagtaggact

      901 gggacaggca gctggagaat tgccatgtag atgttcatac aatcgtcaaa tcatgaaggc

      961 tggaaaagcc ctccaagatc cccaagacca accccaaccc acccaccgtg cccactggcc

     1021 atgtccctca gtgccacatc cccacagttc ttcatcacct ccagggacgg tgaccccccc

     1081 acctccgtgg gcagctgtgc cactgcagca ccgctctttg gagaaggtaa atcttgctaa

     1141 atccagcccg accctcccct ggcacaacgt aaggccatta tctctcatcc aactccagga

     1201 cggagtcagt gagaatattg cctccctggc gagctcacgg ggacagcccc cccccaaagc

     1261 ccccagggat gtaattacgt ccctcccccg ctagggggca gcagcgagcc gcccggggct

     1321 ccgctccggt ccggcgctcc ccccgcatcc ccgagccggc agcgtgcggg gacagcccgg

     1381 gcacggggaa ggtggcacgg gatcgctttc ctctgaacgc ttctcgctgc tctttgagcc

     1441 tgcagacacc tggggggata cggggaaaaa gctttaggct gaaagagaga tttagaatga

     1501 cagaatcata gaacggcctg ggttgcaaag gagcacagtg ctcatccaga tccaaccccc

     1561 tgctatgtgc agggtcatca accagcagcc caggctgccc agagccacat ccagcctggc

     1621 cttgaatgcc tgcagggatg gggcatccac agcctccttg ggcaacctgt tcagtgcgtc

     1681 accaccctct gggggaaaaa ctgcctcctc atatccaacc caaacctccc ctgtctcagt

     1741 gtaaagccat tcccccttgt cctatcaagg gggagtttgc tgtgacattg ttggtctggg

     1801 gtgacacatg tttgccaatt cagtgcatca cggagaggca gatcttgggg ataaggaagt

     1861 gcaggacagc atggacgtgg gacatgcagg tgttgagggc tctgggacac tctccaagtc

     1921 acagcgttca gaacagcctt aaggataaga agataggata gaaggacaaa gagcaagtta

     1981 aaacccagca tggagaggag cacaaaaagg ccacagacac tgctggtccc tgtgtctgag

     2041 cctgcatgtt tgatggtgtc tggatgcaag cagaaggggt ggaagagctt gcctggagag

     2101 atacagctgg gtcagtagga ctgggacagg cagctggaga attgccatgt agatgttcat

     2161 acaatcgtca aatcatgaag gctggaaaag ccctccaaga tccccaagac caaccccaac

     2221 ccacccaccg tgcccactgg ccatgtccct cagtgccaca tccccacagt tcttcatcac

     2281 ctccagggac ggtgaccccc ccacctccgt gggcagctgt gccactgcag caccgctctt

     2341 tggagaaggt aaatcttgct aaatccagcc cgaccctccc ctggcacaac gtaaggccat

     2401 tatctctcat ccaactccag gacggagtca gtgagaatat tcggccgctc tagaactagt

     2461 ggatcccccg ggctgcagga attcgatggc cgcttgggcg ggatatctag cgccaaggtt

     2521 ccgtaaagct ctctattaga ggactggcgg tgccccatca ccctgggagg cctctccaca

     2581 aatatcggct acttccaatt gattggacgc gccatcttgt ctgcttatgc atattcagag

     2641 gatcctgaat attcatgagc gagggccgtg cggcccctcc ctccaaccct cccccggaac

     2701 aagctccgga gaacccgaca ggccccgcct tctttaccga tgcgtagaac aaaccatttt

     2761 ccgggttggg gggggaaatt aatgagagac tttagctgaa aatgagcatg gacgccaaag

     2821 ctgagtaaag atggcttaac tttatcctcc attctgtaat ccgtcagctt gagtgtacgg

     2881 gaagtcggcg aggggggcgg caggctcaga aacattctcc tcctcctgtc gcgtcagaaa

     2941 gaacacccaa ccagggagcc ggagccctgg cgtcaacatc tctggcgcgc gcgctccatg

     3001 taggccggtg cgggcggccc cgtagcgcaa gggagggcgg gaaaggaagg ggcgggacac

     3061 aagggcgaat ctataaaggg cgtcattcag ccagttctct cctcagaagc gccgagagcg

     3121 cgaccgggac ggttggagaa gaaggtggct cccggaaggg ggagagacaa actgccgtaa

     3181 cctctgccgt tcaggatccc ggccatcaag cttatcgatg ctgccgcagc aaaagcagga

     3241 gcagatgccg ccgtcgcagg cgaagatgtc gcagacggag gaggcgatgc tgccggcgga

     3301 ggaggcgaag taagtagagg gctgggctgg gctgtggggg gtgtggggtg cgggactggg

     3361 cagtctggga gtccctctca ccacttttct tacctttcta ggatgctgcc tcgaggaact

     3421 gaaaaaccag aaagttaact ggtaagttta gtctttttgt cttttatttc aggtcccgga

     3481 tccggtggtg gtgcaaatca aagaactgct cctcagtgga tgttgccttt acttctaggc

     3541 ctgtacggaa gtgttacttc tgctctaaaa gctgcggaat tgtacccaat tcgttaaggc

     3601 caaattggcc accatgggct ctagcctgga cgacgagcac atcctgagcg ccctgctgca

     3661 gagcgacgac gaactggtgg gcgaggacag cgacagcgag gtcagcgacc acgtgtccga

     3721 ggacgacgtg cagtccgaca ccgaggaagc cttcatcgac gaggtgcacg aagtgcagcc

     3781 taccagcagc ggctccgaga tcctggacga gcagaacgtg atcgagcagc ctggcagctc

     3841 cctggccagc aacagaatcc tgaccctgcc ccagagaacc atcagaggca agaacaagca

     3901 ctgctggtcc acctccaaga gcaccaggcg gagcagagtg tccgccctga acatcgtgcg

     3961 gagccagagg ggccccacca gaatgtgcag aaacatctac gaccccctgc tgtgcttcaa

     4021 gctgttcttc accgacgaga tcatcagcga gatcgtgaag tggaccaacg ccgagatcag

     4081 cctgaagagg cgggagagca tgaccagcgc caccttcaga gacaccaacg aggacgagat

     4141 ctacgccttc ttcggcatcc tggtgatgac cgccgtgaga aaggacaacc acatgagcac

     4201 cgacgacctg ttcgacagat ccctgagcat ggtgtacgtg tccgtgatga gcagagacag

     4261 attcgacttc ctgatcagat gcctgagaat ggacgacaag agcatcagac ccaccctgcg

     4321 ggagaacgac gtgttcaccc ccgtgcggaa gatctgggac ctgttcatcc accagtgcat

     4381 ccagaactac acccctggcg cccacctgac catcgatgag cagctgctgg gcttcagagg

     4441 cagatgcccc ttcagagtgt acatccccaa caagcccagc aagtacggca tcaagatcct

     4501 gatgatgtgc gacagcggca ccaagtacat gatcaacggc atgccctacc tgggcagagg

     4561 cacccagaca aacggcgtgc ccctgggcga gtactacgtg aaagaactga gcaagcctgt

     4621 gcatggcagc tgcaggaaca tcacctgcga caactggttc accagcatcc ccctggccaa

     4681 gaacctgctg caggaaccct acaagctgac catcgtgggc accgtgcgga gcaacaagcg

     4741 ggagatccca gaggtgctga agaacagcag atccagacct gtgggaacaa gcatgttctg

     4801 cttcgacggc cccctgaccc tggtgtccta caagcccaag cccgccaaga tggtgtacct

     4861 gctgtccagc tgcgacgagg acgccagcat caacgagagc accggcaagc cccagatggt

     4921 gatgtactac aaccagacca agggcggcgt ggacaccctg gaccagatgt gcagcgtgat

     4981 gacctgcagc agaaagacca acagatggcc catggccctg ctgtacggca tgatcaatat

     5041 cgcctgcatc aacagcttca tcatctacag ccacaacgtg tccagcaagg gcgagaaggt

     5101 gcagagccgg aagaaattca tgcggaacct gtacatgagc ctgacctcca gcttcatgag

     5161 aaagagactg gaagccccca ccctgaagag atacctgcgg gacaacatca gcaacatcct

     5221 gcccaaggaa gtgccaggaa caagcgacga cagcaccgag gaacccgtga tgaagaagag

     5281 gacctactgc acctactgtc ccagcaagat cagaagaaag gccaacgcca gctgcaagaa

     5341 atgcaaaaaa gtgatctgcc gggagcacaa catcgacatg tgccagagct gtttctgagg

     5401 ccgtaacggc cgccagaatt ggggatccag acatgataag atacattgat gagtttggac

     5461 aaaccacaac tagaatgcag tgaaaaaaat gctttatttg tgaaatttgt gatgctattg

     5521 ctttatttgt aaccattata agctgcaata aacaagttaa caacaacaat tgcattcatt

     5581 ttatgtttca ggttcagggg gaggtgtggg aggttttttc ggatcctcta gagtcgacct

     5641 gcaggcatgc aagctcggta cccagctttt gttcccttta gtgagggtta attgcgcgct

     5701 tggcgtaatc atggtcatag ctgtttcctg tgtgaaattg ttatccgctc acaattccac

     5761 acaacatacg agccggaagc ataaagtgta aagcctgggg tgcctaatga gtgagctaac

     5821 tcacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg tcgtgccagc

     5881 tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg cgctcttccg

     5941 cttcctcgct cactgactcg ctgcgctcgg tcgttcggct gcggcgagcg gtatcagctc

     6001 actcaaaggc ggtaatacgg ttatccacag aatcagggga taacgcagga aagaacatgt

     6061 gagcaaaagg ccagcaaaag gccaggaacc gtaaaaaggc cgcgttgctg gcgtttttcc

     6121 ataggctccg cccccctgac gagcatcaca aaaatcgacg ctcaagtcag aggtggcgaa

     6181 acccgacagg actataaaga taccaggcgt ttccccctgg aagctccctc gtgcgctctc

     6241 ctgttccgac cctgccgctt accggatacc tgtccgcctt tctcccttcg ggaagcgtgg

     6301 cgctttctca tagctcacgc tgtaggtatc tcagttcggt gtaggtcgtt cgctccaagc

     6361 tgggctgtgt gcacgaaccc cccgttcagc ccgaccgctg cgccttatcc ggtaactatc

     6421 gtcttgagtc caacccggta agacacgact tatcgccact ggcagcagcc actggtaaca

     6481 ggattagcag agcgaggtat gtaggcggtg ctacagagtt cttgaagtgg tggcctaact

     6541 acggctacac tagaaggaca gtatttggta tctgcgctct gctgaagcca gttaccttcg

     6601 gaaaaagagt tggtagctct tgatccggca aacaaaccac cgctggtagc ggtggttttt

     6661 ttgtttgcaa gcagcagatt acgcgcagaa aaaaaggatc tcaagaagat cctttgatct

     6721 tttctacggg gtctgacgct cagtggaacg aaaactcacg ttaagggatt ttggtcatga

     6781 gattatcaaa aaggatcttc acctagatcc ttttaaatta aaaatgaagt tttaaatcaa

     6841 tctaaagtat atatgagtaa acttggtctg acagttacca atgcttaatc agtgaggcac

     6901 ctatctcagc gatctgtcta tttcgttcat ccatagttgc ctgactcccc gtcgtgtaga

     6961 taactacgat acgggagggc ttaccatctg gccccagtgc tgcaatgata ccgcgagacc

     7021 cacgctcacc ggctccagat ttatcagcaa taaaccagcc agccggaagg gccgagcgca

     7081 gaagtggtcc tgcaacttta tccgcctcca tccagtctat taattgttgc cgggaagcta

     7141 gagtaagtag ttcgccagtt aatagtttgc gcaacgttgt tgccattgct acaggcatcg

     7201 tggtgtcacg ctcgtcgttt ggtatggctt cattcagctc cggttcccaa cgatcaaggc

     7261 gagttacatg atcccccatg ttgtgcaaaa aagcggttag ctccttcggt cctccgatcg

     7321 ttgtcagaag taagttggcc gcagtgttat cactcatggt tatggcagca ctgcataatt

     7381 ctcttactgt catgccatcc gtaagatgct tttctgtgac tggtgagtac tcaaccaagt

     7441 cattctgaga atagtgtatg cggcgaccga gttgctcttg cccggcgtca atacgggata

     7501 ataccgcgcc acatagcaga actttaaaag tgctcatcat tggaaaacgt tcttcggggc

     7561 gaaaactctc aaggatctta ccgctgttga gatccagttc gatgtaaccc actcgtgcac

     7621 ccaactgatc ttcagcatct tttactttca ccagcgtttc tgggtgagca aaaacaggaa

     7681 ggcaaaatgc cgcaaaaaag ggaataaggg cgacacggaa atgttgaata ctcatactct

     7741 tcctttttca atattattga agcatttatc agggttattg tctcatgagc ggatacatat

     7801 ttgaatgtat ttagaaaaat aaacaaatag gggttccgcg cacatttccc cgaaaagtgc

     7861 cacctgacgc gccctgtagc ggcgcattaa gcgcggcggg tgtggtggtt acgcgcagcg

     7921 tgaccgctac acttgccagc gccctagcgc ccgctccttt cgctttcttc ccttcctttc

     7981 tcgccacgtt cgccggcttt ccccgtcaag ctctaaatcg ggggctccct ttagggttcc

     8041 gatttagtgc tttacggcac ctcgacccca aaaaacttga ttagggtgat ggttcacgta

     8101 gtgggccatc gccctgatag acggtttttc gccctttgac gttggagtcc acgttcttta

     8161 atagtggact cttgttccaa actggaacaa cactcaaccc tatctcggtc tattcttttg

     8221 atttataagg gattttgccg atttcggcct attggttaaa aaatgagctg atttaacaaa

     8281 aatttaacgc gaattttaac aaaatattaa cgcttacaat ttccattcgc cattcaggct

     8341 gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa

     8401 agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg

     8461 ttgtaaaacg acggccagtg agcgcgcgta atacgactca ctatagggcg aattggagct

     8521 ccaccgcggt g

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart