Human Dual specificity protein phosphatase 1 , DUSP1 Protein

$1,750.00

  • Model: Rp-H000022
  • 5 Units in Stock
Ask a question


Add to Cart:

Human Dual specificity protein phosphatase 1 , DUSP1 Protein
For research use only
Description: recombinant protein with His-tag (partial)
Packing:1mg
Purity:>95%

Search name
Human Dual specificity protein phosphatase 1 Protein, Human DUSP1 Protein, Human Protein-tyrosine phosphatase CL100 Protein, Human Dual specificity protein phosphatase hVH1 Protein, Human Mitogen-activated protein kinase phosphatase 1 Protein, Human MAP kinase phosphatase 1 Protein, Human MKP-1 Protein, Human CL100 Protein, Human HVH1 Protein, Human MKP1 Protein, Human PTPN10 Protein, Human serine/threonine specific protein phosphatase Protein, Human PTPN10 Protein, Human VH1 Protein

 

Protein Accession: NP_004408.1 (305aa-367aa)

Sequence:

LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Gene name: DUSP1

Gene Accession:  NM_004417.3.

Host: E coli

MW: 23.5 KD

Purity:

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart