Human Major facilitator superfamily domain- containing protein 2

$2,580.00

  • Model: Rp-H000026
  • 5 Units in Stock
Ask a question


Add to Cart:

Human Major facilitator superfamily domain- containing protein 2A, MFSD2A Protein
For research use only
Description: recombinant protein with His-tag (partial)
Packing:1mg
Purity:>90%

Search name
Human MFSD2A PROTEIN ,Human MFSD2 PROTEIN ,Human major facilitator superfamily domain containing 2 PROTEIN ,Human major facilitator superfamily domain-containing protein 2A PROTEIN ,Human major facilitator superfamily domain containing 2A PROTEIN ,Human MFSD2A PROTEIN ,Human HMFN0656 PROTEIN ,Human PP9177 PROTEIN ,Human UNQ300/PRO341 PROTEIN ,Human MFSD2 PROTEIN, Human Sodium-dependent lysophosphatidylcholine symporter 1 PROTEIN

 

Protein Accession: NP_116182.2 (453aa-530aa)

Sequence:

agyqtrgcsqpervkftlnmlvtmapivlillglllfkmypideerrrqnkkalqalrdeasssgcsetdstelasil

Gene name: MFSD2A

Gene Accession: NM_032793.4

Host: E coli

MW: 25.58 KD

Applications: AP, Array, ELISA, WB-Re

Storage buffer: Tris-based Buffer(PH8.0) with 10% glycerol

Storage Instruction: Store at -80°C. (avoid repeated freezing and thawing.)

PDF Manual download
 

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart